KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288985Help
Entry
DDB_G0288985      CDS       T00245                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DDB_G0288985 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DDB_G0288985 (purN)
Enzymes [BR:ddi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     DDB_G0288985 (purN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 206 aa AA seqDB search
MTFNICVLISGNGTNLQAIIDAIESKYLNVCIKVVISNKETAYGLERAKKASIETRVFSL
QKYLKQDPINNTRSTYGLELAKIIREYSSIDLIVLAGWMIILPATFLKEFTDNKPTIDII
NLHPALPGQYPGAHAIERAFNDFKENKIKHSGIMIHKVIEEVDAGEVILTKEIPILPTDT
LESLEERFHQQEHKSLVESIKLLSTK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaatatttgtgtattaatatcaggtaatggtacaaatttacaagcaataatt
gatgcaattgaaagtaaatatttaaatgtttgtataaaagttgtaatttcaaataaagaa
acagcttatggattagagagagcaaagaaagcatcaattgaaacacgtgtattctcactt
caaaaatatttaaaacaagatccaatcaataatacacgttcaacctatggattggaatta
gcaaagatcattagagaatactcatcgattgatttaatagttttagccggttggatgatt
atattaccagcaacatttttaaaagaatttacagataataaaccaaccatcgatataatt
aatcttcatccagcattaccaggtcaatatcctggtgcacatgcaatcgaacgtgctttc
aatgatttcaaagaaaataaaataaaacattcaggtataatgattcataaagttattgaa
gaagttgatgctggtgaagttatcttaacaaaagaaattccaatacttccaactgataca
ttagaatctttagaagaaaggtttcatcaacaagaacataaatcattagttgaatcaata
aaattattatcaacaaaataa

DBGET integrated database retrieval system