KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288985Help
Entry
DDB_G0288985      CDS       T00245                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ddi00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ddi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 206 aa AA seqDB search
MTFNICVLISGNGTNLQAIIDAIESKYLNVCIKVVISNKETAYGLERAKKASIETRVFSL
QKYLKQDPINNTRSTYGLELAKIIREYSSIDLIVLAGWMIILPATFLKEFTDNKPTIDII
NLHPALPGQYPGAHAIERAFNDFKENKIKHSGIMIHKVIEEVDAGEVILTKEIPILPTDT
LESLEERFHQQEHKSLVESIKLLSTK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaatatttgtgtattaatatcaggtaatggtacaaatttacaagcaataatt
gatgcaattgaaagtaaatatttaaatgtttgtataaaagttgtaatttcaaataaagaa
acagcttatggattagagagagcaaagaaagcatcaattgaaacacgtgtattctcactt
caaaaatatttaaaacaagatccaatcaataatacacgttcaacctatggattggaatta
gcaaagatcattagagaatactcatcgattgatttaatagttttagccggttggatgatt
atattaccagcaacatttttaaaagaatttacagataataaaccaaccatcgatataatt
aatcttcatccagcattaccaggtcaatatcctggtgcacatgcaatcgaacgtgctttc
aatgatttcaaagaaaataaaataaaacattcaggtataatgattcataaagttattgaa
gaagttgatgctggtgaagttatcttaacaaaagaaattccaatacttccaactgataca
ttagaatctttagaagaaaggtttcatcaacaagaacataaatcattagttgaatcaata
aaattattatcaacaaaataa

DBGET integrated database retrieval system