KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289139Help
Entry
DDB_G0289139      CDS       T00245                                 

Gene name
drpp20
Definition
RNase MRP protein subunit
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DDB_G0289139 (drpp20)
   03008 Ribosome biogenesis in eukaryotes
    DDB_G0289139 (drpp20)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     DDB_G0289139 (drpp20)
Ribosome biogenesis [BR:ddi03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     DDB_G0289139 (drpp20)
Transfer RNA biogenesis [BR:ddi03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    DDB_G0289139 (drpp20)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    DDB_G0289139 (drpp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 228 aa AA seqDB search
MSDTEFEENETNIDETEEDYNEDDENLMSDHKEFLLLNDPTKYVYMRRVVQRPYAKKNEI
YLSNNGKFLYYVKRAKNLLFNQREKEIIIHGLGAAISLAVELSLYLQKDIEGLTLSTTTS
SEEIIDQYDPLVNDLEPVLKIRHASAIHIKIINDGSSTNPNTTNSTTTTTTTTLTPINFR
TTSKKSNSQSKENKKLLKRQELDKKVEQAKSQQKQQREQQQLKVQETC
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatactgaattcgaagaaaatgaaacaaatattgacgaaacagaggaagattat
aatgaagatgatgaaaatttaatgtccgaccataaagaatttttattattaaatgatccc
acaaaatatgtatatatgagaagagttgtacaaagaccttatgcaaagaaaaatgaaatt
tatttatcaaataatggcaaatttttatattatgtaaaaagagcaaaaaatttattattt
aatcaaagggaaaaagaaattataattcatggattaggtgcagcaatttcattagcagtt
gaattatcattatatttacaaaaagatattgaaggattaacattatcaacaacaacatca
tcagaagaaatcattgatcaatatgatccactcgttaatgatttagaaccagttttaaaa
attagacatgcatcagctattcatattaaaattattaatgacggttcttcaacaaatcca
aatacaacaaactctacaactactactaccactacaactttaactccaatcaattttaga
acaactagcaagaaatcaaattcacaatcaaaagaaaataaaaaattattaaagagacaa
gaattagataaaaaagttgaacaagctaaatcacaacaaaaacaacaaagagaacaacaa
caattaaaagttcaagaaacatgttaa

DBGET integrated database retrieval system