KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289139Help
Entry
DDB_G0289139      CDS       T00245                                 

Gene name
drpp20
Definition
RNase MRP protein subunit
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ddi03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:ddi03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 228 aa AA seqDB search
MSDTEFEENETNIDETEEDYNEDDENLMSDHKEFLLLNDPTKYVYMRRVVQRPYAKKNEI
YLSNNGKFLYYVKRAKNLLFNQREKEIIIHGLGAAISLAVELSLYLQKDIEGLTLSTTTS
SEEIIDQYDPLVNDLEPVLKIRHASAIHIKIINDGSSTNPNTTNSTTTTTTTTLTPINFR
TTSKKSNSQSKENKKLLKRQELDKKVEQAKSQQKQQREQQQLKVQETC
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatactgaattcgaagaaaatgaaacaaatattgacgaaacagaggaagattat
aatgaagatgatgaaaatttaatgtccgaccataaagaatttttattattaaatgatccc
acaaaatatgtatatatgagaagagttgtacaaagaccttatgcaaagaaaaatgaaatt
tatttatcaaataatggcaaatttttatattatgtaaaaagagcaaaaaatttattattt
aatcaaagggaaaaagaaattataattcatggattaggtgcagcaatttcattagcagtt
gaattatcattatatttacaaaaagatattgaaggattaacattatcaacaacaacatca
tcagaagaaatcattgatcaatatgatccactcgttaatgatttagaaccagttttaaaa
attagacatgcatcagctattcatattaaaattattaatgacggttcttcaacaaatcca
aatacaacaaactctacaactactactaccactacaactttaactccaatcaattttaga
acaactagcaagaaatcaaattcacaatcaaaagaaaataaaaaattattaaagagacaa
gaattagataaaaaagttgaacaagctaaatcacaacaaaaacaacaaagagaacaacaa
caattaaaagttcaagaaacatgttaa

DBGET integrated database retrieval system