KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290103Help
Entry
DDB_G0290103      CDS       T00245                                 

Gene name
elp3
Definition
GCN5-related N-acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DDB_G0290103 (elp3)
Transfer RNA biogenesis [BR:ddi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DDB_G0290103 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 559 aa AA seqDB search
MSLMNDPRPVSKKAGAKPVYGKNTPQFTKTVGEIVNALINAYKEGKKVNLLKIKTELAAK
NSLSDQPKSVDIISAIPESYKNTLLPLLKAKPVRTASGIAVVAVMCKPHRCPHLAMTGNI
CVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPFLQTRHRIDQLKRLGHNVEKVEFI
IMGGTFMSLPSDYRDYFIRNLHDALSGHTSNNVAEAVKYSEQSNVKCVGITIETRPDHCL
KLHLSNMLTYGCTRLEIGVQSVFEDIARDTNRGHTVRAVLESFQLAKDSGFKVVAHMMPD
LPNMGMERDIYGFMEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGTYKNYSPDSLVDL
IAKVLALVPPWTRIYRIQRDIPMPLVTSGVEYGNLRELCLARMKDFGTKCRDVRTREVGI
QEVHHKIKPDQVELIRRDYVANGGWETFLSFEDPKQDILIGLLRLRKCSETSFRPELKEN
CSIVRELHVYGSVVGIHNRDPTKFQHQGYGTLLMEEAERIAREEHGSIKLAVIAGVGTRH
YYRKLGYELDGVYVSKYLG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatgaatgacccaagacctgtttcaaaaaaagcaggcgctaaaccagtttat
ggtaaaaatacaccacaatttacaaaaactgttggtgaaattgtaaatgcattaattaat
gcttataaagaaggtaaaaaagtgaatttattaaagattaaaacagaattagcagcaaag
aattcattatcagatcaaccaaaatctgttgatattatatcagcaattccagaatcatat
aaaaatacattattaccattattaaaagcaaaaccagttagaacagcatcaggtattgca
gttgttgcagttatgtgtaaaccacatcgttgcccacatttagcaatgactggtaatatt
tgtgtatattgtccaggtggaccagattcagattttgaatattcaacacaatcatataca
ggttatgaaccaacatcaatgagagcaattagagcacgttataatccatttttacaaaca
cgtcatcgtattgatcaattaaaacgtttaggacataatgttgaaaaggtagaattcatt
attatgggtggcacatttatgtcattaccatcagattatagggattatttcattcgtaat
ttacatgatgccttatcgggtcatacatcaaataatgttgcagaagcagttaaatattca
gagcaaagtaatgttaaatgtgttggtattacaattgaaacacgtccagatcattgttta
aaacttcatcttagtaatatgttaacctatggttgtacacgtttggagattggtgtacaa
agtgttttcgaagatattgcacgtgatacaaatcgtggtcatacagtgcgtgccgtattg
gagtcatttcaattggcaaaggatagtggtttcaaagtggttgcacatatgatgccagat
ttaccaaatatgggtatggagagagatatctatggttttatggagttttttgagaatcca
gcatttagagctgacggtttgaaaatctatccaactttggtaattcgtggtacaggtctt
tatgaactttggaaaactggaacctataaaaattattcacccgattctttggtggattta
atcgcaaaggtattggctttggtaccaccttggactcgtatctatcgtattcaaagagat
attccaatgccattggttacaagtggtgtcgagtatggtaatttacgtgaactttgtctt
gctcgtatgaaagattttggtacaaaatgtagagatgttcgtactcgtgaagttggtatt
caagaggtacatcataaaattaaaccagatcaagtcgaattaattcgtcgtgattacgtt
gccaatggtggttgggaaacatttttaagttttgaagatccaaaacaagatattctcatt
ggtttacttcgtcttagaaaatgttcagaaacttcttttagaccagagttaaaggaaaat
tgttcaatcgttagagaattacacgtttatggtagtgtagttggtattcataatcgtgat
ccaactaaatttcaacatcaaggttatggtactttattaatggaagaagctgaaagaatt
gcaagagaagaacatggttcaattaaattggcagttatcgctggtgttggtactcgtcat
tattatagaaaattaggttatgaattagatggtgtttacgtttcaaaatatcttggttaa

DBGET integrated database retrieval system