KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290217Help
Entry
DDB_G0290217      CDS       T00245                                 

Gene name
glb1
Definition
glycoside hydrolase family 35 protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DDB_G0290217 (glb1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    DDB_G0290217 (glb1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    DDB_G0290217 (glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    DDB_G0290217 (glb1)
   00511 Other glycan degradation
    DDB_G0290217 (glb1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DDB_G0290217 (glb1)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDB_G0290217 (glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 671 aa AA seqDB search
MKLIVLIFFLLFINLNYCLKIKEQPKVGGIDSEQPTNSFYIENGNFLMNNQGNGGSLNQY
QIISGSFHYFRCLPELWVDRLTKMKACGLNTIQTYIPWNVHQPNGFNTELVATNDLIEFL
RQAQQIGLNVILRPGPYSCAEWELGGFPYWILEQQPIALRSSDSVFISAVIAYWSRLLPL
LEPLLFTNGGPIIMVQVENEYGSYGEDKSYLETLLTLLQKYLGQGDGNGSGVLFHSTDGP
SAQMLFGSKLEGVYQTVDFGPMPIEQIQDNFKIQQTFASKPTPPMNSEYYTGWITNWGDA
SAARTDASVVAQGLDDILSLNASVNMYMFFGGSNAGFMNGANSNSPTTNFEITIQSYDYD
SPLSESGDTTEKYFAIKNVIEKYIKPTTNSNSTLPPIPSNSTKVAYGTIQITQATSLFNN
LANLVNSNQQQLQTGAPIPMEQLQQSTGFVLYETTMNIAQSSQLSITELHDRATIFINDE
AIEDTQTIGQAVFLQRPFNSSIEITYPSNVTDDGNFNLRILLENQGRVNFGPYLNDRKGL
LSGGVLSGQQYLGPWNNYPLPLTNKTLSNINNWEQIKDYTLSNTPTFYQATLSLNSTNDI
GDTFLSFTGLGKGQLFVNGYNVGRYWNVGPQRTIYISSVLLHQGDNEIILFETLLTQPIF
EIQFLNQPYFD
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaattgtattgatattttttttattatttattaatttaaattattgtttaaaa
ataaaagaacaaccaaaagttggtggtattgatagtgaacaaccaaccaattcattttat
attgaaaatggtaattttttaatgaataatcaaggtaatggtggtagtttaaatcaatat
caaattattagtggatcatttcattattttagatgtttaccagaattatgggtggataga
ttaacaaagatgaaagcatgtggtttaaatacaattcaaacttatataccatggaatgta
catcaaccaaatggtttcaatacagaattagtggcaactaatgatttaatagaattttta
agacaagcacaacaaattggactaaatgtaattcttagacctggtccatattcatgtgct
gaatgggaattgggtggtttcccatattggattttagagcaacaaccaattgcattaaga
agtagtgattctgtattcatttcagctgtcattgcctattggtcgagattattgccattg
ctagagcctttactattcaccaatggtggtccaattataatggtacaagtcgagaatgaa
tacggttcctatggtgaagataaaagttatttggagacattgttaacactacttcaaaaa
tatcttggtcaaggtgatggcaatggttctggtgtgctattccattcaactgatggtcct
tccgctcaaatgctattcggttcaaaattggaaggtgtttatcaaactgttgatttcggt
ccaatgccaatcgagcaaattcaagacaattttaaaattcaacaaacttttgcatcaaaa
ccaactccaccaatgaattctgaatattacactggttggatcactaattggggtgatgct
tctgcagctagaaccgatgcaagtgtagtggctcaaggtttggatgatattctatcattg
aatgcaagtgtaaatatgtatatgtttttcggtggtagtaatgctggttttatgaatggt
gcaaattcaaactcaccaactaccaactttgaaattaccattcaatcctatgattatgat
tcaccattgtctgaaagtggtgatacaactgaaaaatattttgcaataaagaatgtaatt
gaaaagtatattaaaccaaccaccaattcaaatagtactttaccaccaataccttcaaat
agtacaaaggttgcctatggtacaatacaaatcactcaagcaacaagtttattcaataac
ttggctaatttagtcaactcaaatcaacaacaacttcaaactggtgctccaataccaatg
gaacaattacaacaatccactggtttcgttttgtatgaaaccacaatgaatatcgctcaa
agtagtcaattgtcaatcacagagttgcacgatcgtgcaacaattttcataaatgatgaa
gctattgaagatactcaaacaattggtcaagctgttttccttcaaagaccattcaattcc
tcaattgaaattacttatccatccaatgtcactgatgatggtaatttcaatctaagaatt
ttattagagaaccaaggtagagtcaattttggtccttatttaaatgatagaaaaggttta
ttatcaggtggtgttttatctggtcaacaatatctaggaccttggaataattatccatta
ccattaacaaataaaactttatcaaatattaataattgggaacaaatcaaagattatacc
ctttcaaatactccaactttttatcaagcaacactttctttaaactctacaaatgatatt
ggtgatacttttttatcatttacaggtttaggaaaaggtcaactatttgtaaatggttat
aatgttggtagatattggaatgttggtcctcaaagaacaatttatatctcctctgtttta
ttacatcaaggtgataatgaaatcattttatttgaaactctattaactcaaccaatattt
gaaattcaatttttaaatcaaccttattttgattaa

DBGET integrated database retrieval system