KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290453Help
Entry
DDB_G0290453      CDS       T00245                                 

Gene name
usp12
Definition
peptidase C19 family protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DDB_G0290453 (usp12)
Peptidases [BR:ddi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DDB_G0290453 (usp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
5
AA seq 475 aa AA seqDB search
MGNNQTKSDLEKLYEKYPDFPKNQKLFGLENFGNTCYCNSVLQVLYFCVPFRNKILQYYC
ELKGLPPVVINNSNENNNNNNNNNNNSNNDTNNINNDSMNSNNNNSDNNNNNQNSNDSNN
SNSSSGSSGSSSTSYFKNMFNFFGISGSSVNNNNNTNNNNNNNNSYGQSSSFSSSYNNSR
NQEKEGNLIINLGELFYTIHQNKETHGCLKPETFVERLKKENELFSSFMHQDAHEFLNFL
LNSIAEFLQKQQKNKQPQQSSEKKECNKTLVHEIFEGTLTNETKCLTCESITNKDESFLD
LSIDIEQNKSLTNCLSNFSSIEILSKNDKFFCDQCNSLQEAQKRMKIKKLPNTLIIHLKR
FKYMENIQQYTKLNYRVVFPFEIIIQNTTSNIDEPDKKFNLFAVVIHVGSGPNHGHYYSL
IKCHGVWFVFDDHHIDIREESDIYDCFGSSNEFNNDCSYLLFYQCEDSSSNNKQK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataatcaaaccaaatctgatctggagaaattatatgaaaagtatccagatttt
ccaaaaaatcaaaaattatttggtcttgaaaattttggaaatacatgttattgtaattca
gttttacaggtattatatttttgtgtcccatttaggaataaaatactgcaatattattgt
gaattaaaaggattaccgccggtagtaataaataatagcaatgaaaataataataataat
aataataataataacaatagtaataatgataccaataatataaataatgattcaatgaat
agtaataataataatagtgataataataataataatcaaaatagtaatgatagtaataat
agcaatagtagtagtggtagtagtggtagtagtagcacatcatactttaaaaatatgttt
aacttttttggaatttcaggtagtagtgttaataataataataataccaataataataat
aataataataatagttatggacaatcatcatctttttcatcttcatacaataattctaga
aatcaagagaaagaaggaaatttaataataaatttaggagaattattttatacgattcat
caaaataaggaaactcatggttgtttaaaaccagagacatttgtagaaagattaaaaaaa
gagaatgaattatttagtagttttatgcatcaagatgctcacgaattcttaaacttttta
ttaaactcaattgcagaatttttacaaaaacaacaaaaaaataaacaacctcaacaatct
tctgaaaaaaaagaatgcaataaaacattagtacatgaaatttttgaaggtacattaaca
aatgaaacaaaatgtttaacatgtgaatcaattacgaataaggatgaatcatttttagat
ttatcaattgatattgaacaaaataaatcattgacaaattgtttatcaaatttcagttca
attgaaattttatcaaagaatgataaattcttttgtgatcaatgtaattcacttcaagaa
gctcaaaaaagaatgaaaattaaaaaattaccaaatacattaataattcatttaaagaga
tttaaatatatggaaaatattcaacaatatacaaaattaaattatagagtggtttttcct
tttgaaattattatccaaaatactacttcaaatattgatgaaccagataagaaattcaat
ttatttgccgttgtaattcatgttggaagtggtccaaatcatggtcattattatagttta
attaaatgtcatggagtttggtttgtttttgatgatcatcatattgatattagggaagaa
tcagatatatatgattgttttggttcctcaaatgaatttaataatgattgtagttatttg
ctattctaccaatgtgaagatagtagtagtaataataaacaaaaataa

DBGET integrated database retrieval system