KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291283Help
Entry
DDB_G0291283      CDS       T00245                                 

Gene name
sptB
Definition
serine C-palmitoyltransferase subunit
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DDB_G0291283 (sptB)
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     DDB_G0291283 (sptB)
Amino acid related enzymes [BR:ddi01007]
 Aminotransferase (transaminase)
  Class II
   DDB_G0291283 (sptB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 490 aa AA seqDB search
MEDKEDVENVDDVGYLPILFLYIAYAFIIFNGKLAEFIGKLKGERYLHTPEGYAPLFVEF
EYFYQRRMYGRIKDAWDRPINSIAGAWIDVMPRASKHYSQRLELTGGKTIKCLNLGSYNY
LGFAQNEGPVADKVIDSIYKYGVYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMG
FATNSGTLPALIGKGGLIISDSLNHASLATGCKNTGCKVKVFRHNDSKHLEEVIRESIIQ
GQPRTHRPWTMILIIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIGALGKTGRG
IVDYYGIDPKEIDILMGTYTKSFGAIGGYVASDKSLIDHLRQSSFSQVYANSMSPVCAVQ
ALEALRVIMGEDGTDTGAKKLKQLHDNSNYFREKIREMGFVILGNKDSPVIPLMLFNPAK
LSAFSRLCLEKHIAVVVVGYPATPLTEPRTRFCISASHTIEDLDWALRQIDEIGDLITLK
FHKGKYLKSK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaagaagatgtcgagaatgtagatgacgttggctatttaccaattttattt
ttatatatagcatatgcatttatcatttttaatggtaaactagcagaatttattggtaaa
ttaaagggtgaaagatatttacatacaccagagggatatgcacctttatttgttgaattt
gaatatttttatcaaagacgtatgtatggtagaattaaagatgcatgggatagaccaatc
aatagtatagcaggagcatggattgatgttatgccaagagctagtaaacattattctcaa
cgtttagagttaacaggaggaaagacaatcaaatgtttgaatttaggaagttataattat
ttaggatttgcacaaaatgaaggaccagtagcagacaaagtgatcgatagtatctataaa
tatggtgtttacactggtagcacgagtgcagaggtaggattaagtgaaccacaaagagat
ttggagaatttaacagctcgtttcgttggaaaagaggatgcaatcgtatttgaaatggga
tttgcaaccaactctggtacattaccagcattgattggtaagggtggtttaatcattagt
gattcattgaatcatgcatcattggccaccggttgtaagaatacaggttgtaaagttaag
gtatttcgtcataacgattccaaacatttggaagaggtcattagagagtcaatcattcaa
ggtcaaccacgtactcatcgtccatggactatgattttaatcattattgaaggtatctac
tctatggagggtgaggttgcaaatcttccagagattcttgccatcaaaaagaagtacaaa
tgttacctctacatcgatgaggctcattcaattggtgcccttggtaaaacgggtcgtggt
atcgtcgattactatggtatcgatccaaaggagatcgatatccttatgggtacttacaca
aaatcatttggtgcaatcggtggttatgttgcaagtgataaatctttgatcgatcatctt
cgtcaatcttctttctctcaagtttatgcaaatagtatgagtccagtttgcgctgtgcaa
gctttggaggctttacgtgttatcatgggtgaagatggtactgacactggtgcaaagaaa
ttaaaacaattacatgacaattcaaattactttagagagaaaattcgtgaaatgggtttc
gttatcttgggtaataaagactctccagtcattcctttgatgttatttaatcctgctaaa
ttatcggctttctcccgtctttgtctagagaaacatattgctgtcgttgtcgttggttat
cctgctacacctttaactgaaccacgtactcgtttctgtatttcagcttctcataccatt
gaagatttggattgggcacttcgtcaaattgatgagattggtgatcttatcactttgaaa
ttccataaaggaaaatatttaaaaagtaaataa

DBGET integrated database retrieval system