KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291376Help
Entry
DDB_G0291376      CDS       T00245                                 

Gene name
adi1
Definition
ARD/ARD' family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DDB_G0291376 (adi1)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     DDB_G0291376 (adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     DDB_G0291376 (adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 147 aa AA seqDB search
MKSYFYDNESDVISLDYLKEHNVLYFPMDREKENYKEPLETLCKERGYKNRDEVKLSKET
PGLEDKLKIFFEEHLHDDEEIRFILDGCGFFDIRDKNDKWVKIKEKKGDLIIVPANMYHR
FALDESRNIHAMRLFTDAPKWVPINRY
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttatttttatgataatgaaagtgatgtaatttcacttgactatttaaaagaa
cacaatgtattatattttccaatggatagggaaaaggaaaattataaagaacctttagag
accctttgtaaagaaagaggttacaaaaatagagatgaagttaaattatcaaaagaaaca
ccaggtttagaagataaattaaaaattttctttgaagaacacttacatgatgatgaagaa
attagattcattttagatggttgtggtttctttgatattcgtgataaaaatgataaatgg
gttaaaattaaagaaaaaaaaggtgatttaattatagttccagcaaatatgtatcatcgt
tttgcacttgatgaaagtagaaatattcatgcaatgagattatttactgatgctccaaaa
tgggtaccaattaatagatattaa

DBGET integrated database retrieval system