KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292602Help
Entry
DDB_G0292602      CDS       T00245                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DDB_G0292602
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    DDB_G0292602
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     DDB_G0292602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 292 aa AA seqDB search
MNFLIKKLTNNTNNKQFIQSTIRYYSTNQNGRMEKKVCFVTGGASGIGLGIVERFVKEGG
KVAIVDLDKTKADNASKELNQRFPGSTISVECDVSNEEQVSKGIKDTVERFGGLDVIVSN
AGLQHIETLETVELATWRKMMAVHLDGAFLCTKYAMQEFKKDIKRGGTILYMGSVHSKYA
SEYKIPYVTAKHGLEGLCRGVAREGAKHNIRANLICPGFVLTPLVKNQIPDLAKKFNITE
EQVTKNILLKETVDGEFTTVEDVAEVAVNFSSIPNKCLTGQSLLVSHGWIME
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttaattaaaaaattaacaaataatacaaataataaacaatttattcaatca
accattagatattatagtacaaatcaaaatggtagaatggaaaaaaaagtttgttttgta
acaggtggagcatcaggtattggtttaggaattgttgaaagatttgttaaagaaggtggt
aaagttgcaattgtagatttagataaaaccaaagctgataatgcatcaaaagaattaaat
caacgttttccaggatcaacgatttctgttgaatgtgatgtatcaaatgaggaacaagtt
tcaaagggtattaaagacacagttgaaagatttggtggattggatgtgattgtgtcgaat
gcaggtttacaacatattgaaacattagaaaccgttgaattggcaacttggagaaaaatg
atggccgttcatttagatggcgctttcttatgtacaaaatatgcaatgcaagaatttaaa
aaggatattaaacgtggtggtacaattctatatatgggtagtgttcatagtaaatatgca
tcagaatacaaaataccatatgtaactgccaaacatggtttggaaggtttatgtcgtggt
gtcgctcgtgaaggtgcaaaacataacattcgtgcaaatttaatttgtccaggtttcgta
cttactccattggttaaaaatcaaattccagatttagcaaagaaattcaatatcactgaa
gaacaagtcactaaaaatatccttttaaaagaaactgttgatggtgaattcacaacagtt
gaagatgttgctgaagttgctgttaacttttcttcaattccaaataaatgtttaactggt
caatcattattagttagtcatggttggattatggaataa

DBGET integrated database retrieval system