KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292862Help
Entry
DDB_G0292862      CDS       T00245                                 

Gene name
ppt3
Definition
palmitoyl-protein thioesterase 3
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DDB_G0292862 (ppt3)
  Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0292862 (ppt3)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DDB_G0292862 (ppt3)
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0292862 (ppt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 289 aa AA seqDB search
MRILSSLILLIALAIALVSATRPVVLMHGVTTGKESMEPLKSWIEESIPDIYVLNVEIGN
GAFDSIFTTMDSQIEEFAQVVQADPKLANGFNLIGFSQGTLIARAFVQRYNNPQVYNYIS
WNGPQGGQFGTPFVNIPWVDKVLGTIPYEKTIQKKLSVAEYWKDPHRIDKYLERSIFLAD
INNEYQVKNTTYKENLTKLNAMVLTYSTNDKTIIPKESGWFSFYADGSGTEVVPLQQQTQ
YSEDWLGLRTLDESNRLFFYTTTCTHRDHPIEDYCKPYFTNFTLPYLQN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttatcaagtttaattttattaattgctttagcaattgcacttgttagtgcc
accagaccagttgtattaatgcacggtgttacaactggtaaagaatcaatggaaccatta
aaatcttggattgaagaatctattccagatatttatgttttaaatgttgaaattggaaat
ggtgcatttgattcaattttcactactatggattcacaaattgaagaatttgctcaagtt
gtccaagccgatccaaaattagcaaatggtttcaatttaattggtttcagccaaggtact
ttaattgctcgtgcattcgttcaacgttataataatccacaagtatacaattatattagt
tggaatggtccacaaggtggtcaattcggtactccatttgttaatattccatgggttgat
aaggtacttggtacaattccatatgaaaaaactattcaaaagaaactttcagttgctgaa
tattggaaagatccacatagaattgataaatatcttgaaagatcaatctttttagcagat
attaataatgaatatcaagttaaaaatacaacttataaagaaaatctcacaaaattaaat
gctatggttctcacttatagtacaaatgataaaaccatcattccaaaagaatctggttgg
ttcagtttttatgctgatggtagtggtacagaagttgttccattacaacaacaaacacaa
tactctgaagattggttaggtttaagaactcttgatgaatcaaatcgtcttttcttctat
accacaacttgcactcatcgtgatcacccaattgaagattattgcaaaccatactttaca
aactttactttaccatatttacaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system