KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293228Help
Entry
DDB_G0293228      CDS       T00245                                 

Gene name
gtf2h4
Definition
TFIIH subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DDB_G0293228 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    DDB_G0293228 (gtf2h4)
Transcription machinery [BR:ddi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DDB_G0293228 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 483 aa AA seqDB search
MTLSKVFQYLASLDSKDLEELYKDPWTCQAILRSLPPRSKQYILKMLLVDTYPLSLAKDW
STQASIQQHKESLKKLFDLKIIFLDKINKPIQPQQQQSSQQSSSQQQQQQQQQQQQTEQT
IRLNPLFQDNIKRSLVQVNQVIFSNNSSIKDNHKPPSIDDLDSYSKSQWEKVLYFLSDDT
VQPSKLISELLLSSNLTKQEGDGLSITSEGFKFLLKDVYTQIWTLLIVYLDDLEKKKGKG
SGSRNDLLSFLFRLSFLNLGRGYLVSELSEQQKEYLFALKQFGLIYMRTDSSILFYPTRL
IISLTTGKTLSLIQSISSERTQTQKEQGYIVLETNYRLYAYTSSSLQISLLSLFVKMLYR
LPNLAVGIITRESIRTALIHGITADQIIDFVRHNSHPNAANSGQPIPDVVAEQILLWEAE
RNRITYTKSVLYNSFPTNDCYIATLKFAKEQDYYIWSHDPLKTLVVKEEGNDPIRNFIKK
NFA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcaaaagtatttcaatatttagcaagtttagattcaaaagatttagaagaa
ttatataaagatccatggacatgtcaagcaattctaagatcattaccaccaagatcaaaa
caatatatattaaagatgttattagttgatacttatcctctaagtttagcaaaggattgg
tcaacacaagcatcaatacaacaacataaagaatcattaaagaaattatttgatttaaaa
attatctttttagataaaattaataaaccaattcaaccacaacaacaacaatcatcacaa
caatcatcatcacaacaacaacagcaacaacaacagcaacaacaacaaactgaacaaaca
attagattaaatccattatttcaagataatataaagaggtcattagttcaagtcaatcaa
gtaatattttcaaataatagtagtataaaagataatcataaaccaccaagtattgatgat
ttagattcatattcaaaatcacaatgggagaaagttttatattttttatcggatgataca
gttcaaccatcaaagttaatatcggaattattgttatcatcaaatttaacgaaacaagag
ggtgatggattatcaattacatcagaggggtttaaatttttattaaaagatgtttataca
caaatttggacattgttaattgtttatttggatgatttggagaaaaagaaaggtaaagga
agcggatcgagaaatgatttgttaagttttttatttaggttatcatttttgaatttgggt
agaggttatttagtttcagaattgtctgagcagcagaaagagtatttattcgcattgaag
cagtttggcttgatttatatgaggactgatagcagtatactgttttatccaactcggtta
atcatttcattgaccactggtaaaacgttgtcgttgatacaaagtatttcgtcagagaga
actcagactcagaaggagcagggctatatagtgttggagacgaattacagactttacgca
tacacctcttcctctttgcaaatctcgttgttgagtttgttcgtcaagatgttatatagg
ttaccgaatttagcggttggtatcattacgagggagagtattagaaccgctttgattcat
ggtataactgctgaccaaatcattgactttgttagacataatagtcatccaaatgctgcc
aactctggtcaaccaataccagatgtcgtcgctgaacaaatcttactttgggaagctgaa
agaaatcgtatcacttatactaaatctgtactctataattcatttccaacaaatgattgt
tatattgcaacattaaaatttgcaaaagaacaagattattatatttggtctcatgatcct
ttaaaaactttagttgttaaagaagaaggaaatgatccaattagaaattttattaaaaag
aattttgcttga

DBGET integrated database retrieval system