KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293228Help
Entry
DDB_G0293228      CDS       T00245                                 

Gene name
gtf2h4
Definition
TFIIH subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ddi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ddi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 483 aa AA seqDB search
MTLSKVFQYLASLDSKDLEELYKDPWTCQAILRSLPPRSKQYILKMLLVDTYPLSLAKDW
STQASIQQHKESLKKLFDLKIIFLDKINKPIQPQQQQSSQQSSSQQQQQQQQQQQQTEQT
IRLNPLFQDNIKRSLVQVNQVIFSNNSSIKDNHKPPSIDDLDSYSKSQWEKVLYFLSDDT
VQPSKLISELLLSSNLTKQEGDGLSITSEGFKFLLKDVYTQIWTLLIVYLDDLEKKKGKG
SGSRNDLLSFLFRLSFLNLGRGYLVSELSEQQKEYLFALKQFGLIYMRTDSSILFYPTRL
IISLTTGKTLSLIQSISSERTQTQKEQGYIVLETNYRLYAYTSSSLQISLLSLFVKMLYR
LPNLAVGIITRESIRTALIHGITADQIIDFVRHNSHPNAANSGQPIPDVVAEQILLWEAE
RNRITYTKSVLYNSFPTNDCYIATLKFAKEQDYYIWSHDPLKTLVVKEEGNDPIRNFIKK
NFA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcaaaagtatttcaatatttagcaagtttagattcaaaagatttagaagaa
ttatataaagatccatggacatgtcaagcaattctaagatcattaccaccaagatcaaaa
caatatatattaaagatgttattagttgatacttatcctctaagtttagcaaaggattgg
tcaacacaagcatcaatacaacaacataaagaatcattaaagaaattatttgatttaaaa
attatctttttagataaaattaataaaccaattcaaccacaacaacaacaatcatcacaa
caatcatcatcacaacaacaacagcaacaacaacagcaacaacaacaaactgaacaaaca
attagattaaatccattatttcaagataatataaagaggtcattagttcaagtcaatcaa
gtaatattttcaaataatagtagtataaaagataatcataaaccaccaagtattgatgat
ttagattcatattcaaaatcacaatgggagaaagttttatattttttatcggatgataca
gttcaaccatcaaagttaatatcggaattattgttatcatcaaatttaacgaaacaagag
ggtgatggattatcaattacatcagaggggtttaaatttttattaaaagatgtttataca
caaatttggacattgttaattgtttatttggatgatttggagaaaaagaaaggtaaagga
agcggatcgagaaatgatttgttaagttttttatttaggttatcatttttgaatttgggt
agaggttatttagtttcagaattgtctgagcagcagaaagagtatttattcgcattgaag
cagtttggcttgatttatatgaggactgatagcagtatactgttttatccaactcggtta
atcatttcattgaccactggtaaaacgttgtcgttgatacaaagtatttcgtcagagaga
actcagactcagaaggagcagggctatatagtgttggagacgaattacagactttacgca
tacacctcttcctctttgcaaatctcgttgttgagtttgttcgtcaagatgttatatagg
ttaccgaatttagcggttggtatcattacgagggagagtattagaaccgctttgattcat
ggtataactgctgaccaaatcattgactttgttagacataatagtcatccaaatgctgcc
aactctggtcaaccaataccagatgtcgtcgctgaacaaatcttactttgggaagctgaa
agaaatcgtatcacttatactaaatctgtactctataattcatttccaacaaatgattgt
tatattgcaacattaaaatttgcaaaagaacaagattattatatttggtctcatgatcct
ttaaaaactttagttgttaaagaagaaggaaatgatccaattagaaattttattaaaaag
aattttgcttga

DBGET integrated database retrieval system