KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293750Help
Entry
DDB_G0293750      CDS       T00245                                 

Gene name
dyrk2
Definition
DYRK family protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     DDB_G0293750 (dyrk2)
Protein kinases [BR:ddi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   DDB_G0293750 (dyrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 915 aa AA seqDB search
MTSLHKQIIESHNNDITKLKSSMSTRAAARRSVCLSSMSYTLGADDVTPITSNTTPSNNN
NNNNTTTTITTTTTTPTISPLKQSTTGSIIPKSILVTKSGSKEEPIVSSSKSSSNSSSIN
NNFNNLYSASTFSSSTKKVHERPSINPGFRKPREALLSGNSDSGIIKKPSSSSTSSSSSS
SSTTSNIKAPIQISHSSNSGSSSSGGNNNNSDDNSGSSTIKHTAASLSKMKLSPSHTISD
SPRSSTMKSRSVSISNGSLFSPTNTSVNNSNNNTSSNIKTPTKSSISENLDQNTPPPPSS
SSTTKTPTATTTTTTTTTSSSSSTSTNTTPSKSSVDDVFARLANVSKPAIKSRSLSVSAS
LARVEQSPPTKDKGDKESSSSSSSSSSSFSSKFTKILRSSSKTPTPTSSNTTVQPSTTSL
SASKISSRKDTKSLSSFSTTTTTTTLKSSSSSSSSSSSSSKSNIASSSSSSSNNLTNLLT
QSQSISSTSTSTTTTPTSTSPTLASSMSVLSSPTSTTTTSTSTTSTTTTPTKSSCTIITP
SIALKLYINDLTSAEQSEILDYPQIYFTGNTNKKTKFNSQLPNNGYDNDIGEYKVVERDH
IAYRFEIVSILGQGSFCQVVKGYDYKTGEMVALKILRNQKRFHNQALTEIKILEYLKTND
PNSTASIVHLNNYFYFRNHLILTFELLSMNLYDFLKVNHFQGYNLNLVRRFGAQILTSLR
FLSKRNIIHADLKPENILLKSPTKSGIKLIDFGSSCFENEQIFTYIQSRFYRSPEVILGT
KYDKSIDIWSLGCILVEIFTGVPLFPGSDEPEQLACIMEVLGAPPKSVIDNSTRKDIFFE
DDGTPKPVKNSTTGELYTIGTKSFKDSIRSGDEDFDNFILDCLKWEPSQRITAEQGLKHD
WIIKVIAPTAPSTPS
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcattacataaacaaattattgaatcacataataatgatataaccaaattgaaa
tcatcaatgtcaacaagagcagctgctagaagaagtgtttgtttatcttcaatgtcttat
acattaggtgctgatgatgttacaccaatcacctcaaatacaacccctagtaataataat
aataataataatactaccaccaccataactaccacaactaccaccccaaccatatcacca
ctaaagcaatcaactacaggtagtattatacccaaatcaattttagttacaaaatcaggc
tcaaaggaggaacctattgtatcatcctcaaaatcaagtagtaatagtagtagtatcaat
aataactttaataatttatattcagcatcaacatttagtagtagtacaaagaaagtacat
gaaagaccaagtataaatccaggttttagaaaaccaagagaggcattattaagtggtaat
agtgatagtggtattattaaaaaaccatcttcatcatctacttcttcttcttcttcttct
tcttcaactactagtaatataaaagcaccaattcaaatttcacattctagcaatagtggt
agtagtagtagtggtggtaataataataatagtgatgataatagtggcagctctacaatt
aaacatactgctgcatcattatcaaaaatgaagttatcaccatcgcacacaatttctgat
tctccaagatcctcaactatgaaatctagatctgtttcaatttcaaatggtagtttattc
tcaccaaccaatacttctgtaaataatagcaataacaatacatcatcaaatataaaaacc
ccaaccaaatcatcaatatctgagaatttagatcaaaatacaccaccaccaccatcatca
tcatcaacaacaaaaacaccaactgcaacaacaacaacaacaacaacaacaacatcatca
tcgtcatcgacatcaacaaatacaacaccttctaaatcatcagtggatgatgtttttgca
agattagccaatgtatcaaaacctgcaattaaatcaagatcattatctgtttctgcaagt
ttggcaagggttgaacaatccccaccaactaaagataagggagataaagaatcttcatct
tcgtcctcctcttcttcatcttcattttctagtaaatttacaaaaatacttaggagttca
tcaaaaacaccaacaccaacttcatccaacactacagtacaaccctcaacaacctcatta
tcagcatcaaagatatcatctagaaaagatacaaaatcattatcatctttttcaactaca
actactactactactttaaaatcctcatcatcatcatcatcatcatcatcatcatcatca
aaatcaaatatagcatcaagctcatcaagttcatcaaataatttaacaaacttactcaca
caatcacaatcaatttcgtcaacatcaacatcaacaacaacaacaccaacttcaacttca
ccaacattggcatcatcaatgtctgtattatcatcaccaacttcaaccactaccacctcc
acctctaccacctccacaacaacaacaccaaccaaatcatcatgtactattataacacca
tcgattgcattgaaattatatataaacgatttaacatcagcagaacaatcagagattctg
gattatcctcaaatctatttcactggtaataccaataaaaaaacaaaattcaattcacaa
ttaccaaacaatggttatgataatgatattggtgaatataaagtggttgaacgtgatcat
atagcatatcgttttgaaatcgtttcaatacttggtcaaggttcattctgtcaagtagta
aaaggttatgattataaaactggtgaaatggttgctttaaaaattttacgtaatcaaaaa
agatttcataatcaagctttaactgaaattaaaattttagaatatttaaaaacaaatgat
ccaaattcaacagcaagcattgtccatttaaataattatttttattttagaaatcattta
attttaacatttgaattattaagtatgaatttatatgattttttaaaagtaaatcatttc
caaggttataatttaaatttagttagaagatttggcgctcaaatcttaacttcacttaga
tttttatcaaagagaaatataattcatgccgatttaaaacctgaaaatattttattaaaa
tcaccaactaaatctggtataaaattaattgattttggtagtagttgttttgaaaatgaa
caaatttttacatatattcaatcaagattttataggtcaccagaagttatattgggaact
aaatatgataaatcgattgatatttggagtttaggttgtatattagtagagattttcaca
ggtgtaccattatttccaggatctgatgaacctgaacaattagcatgtataatggaggtg
cttggagctcccccaaaaagtgtaattgataattcaacacgtaaggatattttctttgaa
gatgatggtactccaaaacctgttaaaaactcaacaactggagaactctatacaattggt
acaaaatcttttaaggattcaattagatcgggtgatgaagattttgataatttcattttg
gattgcttaaaatgggaaccatctcaaagaattactgctgaacaaggtttaaaacatgat
tggataattaaagttattgctccaactgcaccttcaacaccttcttaa

DBGET integrated database retrieval system