KEGG   Desulfitobacterium dichloroeliminans: Desdi_0022Help
Entry
Desdi_0022        CDS       T02390                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desdi_0022
DNA repair and recombination proteins [BR:ddl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desdi_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18279..18875
Genome map
AA seq 198 aa AA seqDB search
MDFLSYPQPLADLIAGLSRLPGIGPKTAGRLAFYLLQQPQVAENLAETIIKAQREIKQCS
LCCNYTDQDPCPICEGEKRDRSLLCIVEQPRDVVSLEKTREFKGRYHVLHGVISPLEGIG
PEQLTISKLLTRLEEVKEVVMAVNPTVEGEATAMYLAKLLKPLGIRVTRIAHGLPVGGDL
EYADEITIARALEGRRQI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttttaagctatccacagcccctagcggatttgattgccggtttatcccgtttg
ccggggattgggccgaaaaccgcagggagattggcattctatcttttgcaacagcctcaa
gtagcagagaacttggcagaaacgatcatcaaggcccaaagggaaattaaacaatgctcc
ctttgctgtaattatacagatcaggatccttgcccgatctgtgagggggagaaaagggat
cgctccctcttatgcattgttgaacagcccagagatgttgtgtctttagaaaagacgaga
gagtttaaaggtcgctaccatgtgttacatggtgtgatctctcccttggaaggaattggc
ccagagcaactcacgatttccaaactcttgacgcgcctggaggaagtcaaggaagtagtc
atggctgtgaaccctaccgtggaaggtgaagcaactgccatgtacttagctaagctgttg
aagcccttgggaataagagtgacacggatagcccatggattaccggtaggtggtgatctg
gagtacgcggatgagattaccatagcccgcgctctcgagggccgtcgtcaaatctaa

DBGET integrated database retrieval system