KEGG   Desulfitobacterium dichloroeliminans: Desdi_0051Help
Entry
Desdi_0051        CDS       T02390                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ddl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53092..53964
Genome map
AA seq 290 aa AA seqDB search
MSQNQVELFAYAKINLALAVTGRRSDGYHELESVMQSIGLSDRIRITLTERGIECSCGEW
SGPENLAYQAARVFLAGLNTTSGIKIEIEKNIPVQAGLGGGSADAAATLYALNHLFQEPY
SLEQLKSLAAGLGADVAFCLQGGTQWATGVGDVLKDLPLAPRIHLVIVKPWQGVNTALAY
RTFDQESKFTHLSYEEWRKALALKQAEALAPLLYNDMEPASMKLLPEIARIKEDLQKEEG
CLGALMSGSGSAVFGMFQSSEQAQRVVGSWQDKECKVWVTHTVERGHCHG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaatcaggttgaattgttcgcttatgccaaaattaatctcgccctagccgtt
acggggcgtcgctctgatggctatcatgaattggaaagcgttatgcaatccattggcttg
tctgatcggattcggatcaccctaaccgagaggggtatagagtgctcctgtggtgagtgg
agtggacctgaaaacctcgcttatcaggcagcacgggtttttctggctggattgaacaca
acctccggtataaaaatagaaatagagaaaaatatccctgttcaagcagggttaggggga
ggcagcgcagacgcagctgcaactctatatgctctcaatcatctgtttcaagaaccgtat
tccttggaacaacttaagagtctggccgccggcttgggtgcagatgtggccttttgctta
caaggtgggacccaatgggccaccggggtcggtgatgtattaaaggatttacccctagca
cctcgaatccatttggtaatcgttaaaccgtggcaaggggtgaatacagccctagcttat
cgcacttttgatcaggaaagtaagtttacacacttatcttacgaagagtggcggaaggct
ttagcattgaagcaagcggaagccctggcaccattgctttataatgatatggagcctgcc
tccatgaagcttctcccggaaatagctcgcatcaaagaagatttacagaaggaagaaggg
tgtctgggcgctttaatgtccggcagcggctcagcggtattcgggatgtttcaatcctct
gaacaggcacaaagagttgtcggttcgtggcaagataaagaatgcaaggtttgggtaacg
catactgtggaaaggggacattgtcatgggtag

DBGET integrated database retrieval system