KEGG   Desulfitobacterium dichloroeliminans: Desdi_0167Help
Entry
Desdi_0167        CDS       T02390                                 

Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Desdi_0167
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Desdi_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168678..170588
Genome map
AA seq 636 aa AA seqDB search
MDKDLFKKVVLSLAGLLVGLVIAVYLSTQLNPAGGSEATLGGAANISVDGVSDDIVQAAL
KTYVPPGQLDEYYMFASGGHSGNVFVYGVPSMRRIRTIPVFTPESSVGYGWTAESKEMLG
EWSWGDVHHPALSETGGDYDGRWLFVNDNANSRAARINLDSFRTSQILEVPNIYGPHSAV
FMTPNSEYFMMGSRFAGPIPYGTYSPIENYSKDYKGVLAAIAINQESGEMNIGWEVLLPP
WSYDLSDAGKLDSEGWAFLTTYNTEEAYELLEVNASQREMDYVVALNWKLLEQAANEGKF
EMVEGVKMIDPLDVPGSIYLIPAMKSPHGVDVTPDGKYIVANGKVAPVATVFSFEKFMEC
VNNKDFQGEERGFPIINYEKVRVAEVPVGLEPLHTQFDGNGYAYTTLFIDSTIAKWSLDT
FEIVDVTPVHYCPGHLCAAEGDTVDPDGKYLVSLNKLAKDKFLSVGPSHPESAQLIDLTT
DKMKILMDVPTDPEPHFAQMIKADKIKTFEVFEKDPNRLGAVYEKENARIERDGNNVTIY
QMSFRSRYYPDHVEVNEGDHVTWYVTNTDFDEDITHGFGITRYDLNMEVQPGETQKFEFV
ADRAGVYPFYCTNFCSALHQEMQGWFIVKPKGQQKT
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggataaggatcttttcaaaaaggttgtattatctttagccgggttgctggttggtttg
gtaattgcggtctatttatcgacacagcttaacccagccggtggttcagaagctacctta
ggcggagcggcgaatatatcggtagatggggtgtctgatgatatcgtgcaagcggctctg
aagacttatgtaccgcccggtcagttggatgagtattatatgttcgcttcagggggccat
tccggcaatgtttttgtctatggtgtcccctccatgcggcggatccgtacgattccggta
ttcacaccggagtcttccgtgggctatggctggacagcagaatctaaggaaatgcttggg
gaatggagttggggagatgtccaccaccctgctttgagtgaaacaggtggggattatgac
gggcgctggctctttgtcaatgataatgccaacagccgggcagcccgaattaatctggat
tctttccgaaccagtcagatcttagaggttcccaatatttatggacctcacagtgcggtg
tttatgaccccgaattcagaatactttatgatgggctcccgctttgccggaccgatacct
tatggtacctattcacccattgaaaactattccaaggattataagggagttctggcggcc
atagccatcaatcaggaaagcggcgagatgaacattggctgggaagtattattacctccc
tggtcttacgatttatccgatgcaggtaagctggacagcgagggttgggcatttttaaca
acctataatactgaagaagcttacgaattgctagaggttaatgcctcacagcgggagatg
gactatgtcgtcgctttaaactggaagctgttggaacaagcagctaatgaaggaaagttc
gaaatggtagaaggggtcaaaatgattgatcctctggatgtccccggttctatctacctg
attccggctatgaagagccctcacggcgtcgatgtaacaccggatggcaaatatattgta
gccaacggcaaggttgcgccggtagccaccgtgtttagttttgagaaatttatggaatgc
gtcaacaacaaggattttcaaggcgaagaacgaggctttccgattataaattatgagaaa
gttcgtgtggcggaagtgcctgtgggcttagaacctttgcatactcaatttgatggtaac
ggttatgcctatactactttatttattgacagtaccattgctaaatggagtcttgacacc
tttgaaattgtcgatgtaactccagttcactactgtcctgggcatctgtgtgctgctgag
ggagatactgttgatcctgacggcaagtatttggtatctctgaataagcttgccaaggac
aaattcctatctgttggcccttcccatccggagagtgcccagctgatcgatttaaccaca
gataagatgaaaattttgatggatgttcctacagaccctgaacctcactttgctcagatg
atcaaagccgataagattaaaacctttgaggtattcgagaaggatcccaaccgactgggc
gctgtttatgaaaaggaaaatgcccggatagaacgggacggtaacaatgtcacaatttat
caaatgtccttccgcagccgttattaccctgatcatgtggaggtcaatgaaggggatcat
gtgacctggtatgtgacaaatacagattttgacgaagatattacccatggatttggtatt
accaggtatgacctcaatatggaggtccaacctggagaaacgcagaaatttgaatttgtt
gccgatagggcgggagtctatcccttctattgtaccaacttctgctcggcgctccatcag
gaaatgcagggttggtttatcgtcaaaccaaagggtcaacaaaagacttaa

DBGET integrated database retrieval system