KEGG   Desulfitobacterium dichloroeliminans: Desdi_0409Help
Entry
Desdi_0409        CDS       T02390                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desdi_0409
Enzymes [BR:ddl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Desdi_0409
Amino acid related enzymes [BR:ddl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Desdi_0409
Transfer RNA biogenesis [BR:ddl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desdi_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436218..437675
Genome map
AA seq 485 aa AA seqDB search
MLKVRFAPSPTGPLHIGGARSALFNYLLSRKENGVFIVRSEDTDLERSSRESEHNILEAL
RWLNIQWDEGIEVGGDNGPYRQTERLALYHEYTDKLMASGDAYHCYCSEEELEQERQELI
AKGDTPRYLGKCRHLTDEDRQKYEAAGRKPVVRFRVPEGQQIVIRDRVRGEVIFESDGIG
DYVIVKSDGIPTYNFAVVIDDMTMKVTHVIRGEEHLSNTPRQILIYQALGLTPPEFAHVS
LILNTEGKKMSKRDGDTAVIDYQGKGYLPEAVANFIALMGWSPAGEEEFFTLEEMIQAFS
LDRVSKSPAVFDLNKLNYMNAHYIKKADPERLTDLALPYLQEVGIIPREEISDTDRAWAT
RYVQAIINHLDYLAQVKDYIHYVRGGEAPAPEGEALEILQGEQVTSVLDLFVEKLKSLDE
ITVDTVKPLFKQVTKELKLGGKQVFMPIRIALTGQMHGPELYDIVPLLGLDNVMSRLEGS
KKLLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagttcgttttgcccccagcccaacggggcccttacatatcggcggtgcacgt
tccgctctttttaactatttgttgtcccgtaaggaaaatggggtatttatcgtgcgcagt
gaagatacagacttagagcgatccagtcgggaatcggaacataatatcctcgaagcctta
cgctggttgaatatccagtgggatgaaggaatcgaagtgggtggcgacaacggaccgtat
cgacaaaccgagcgcctagccctttatcacgaatacacggacaagctcatggccagtggc
gatgcttatcattgctattgttcggaagaagagctggagcaagagcgtcaggaattaatc
gccaaaggggatacccctcgttatctaggtaaatgccgacatcttacagacgaagatcgt
cagaaatacgaagcggctggccgtaagccggtggttcgtttccgggtgcctgaagggcag
cagattgtgatccgcgatcgggtccggggcgaggtcatttttgaaagtgacggaatcggg
gattatgtcattgtaaaatccgacggtattcctacctataattttgcggtggtcattgac
gatatgaccatgaaggtgacccatgttattcgcggggaagagcatctttccaatactcct
cggcaaattcttatctaccaggccttagggcttaccccaccagaatttgctcatgtctcc
ttgatcctcaacactgaagggaaaaaaatgagcaaacgggatggggatacagctgttatc
gattatcagggaaaaggatatttgccagaagcggtcgcgaacttcattgctctgatggga
tggtctcctgctggagaggaagagtttttcacccttgaagaaatgattcaggccttctct
ctcgatcgggtctccaagagcccggcggtttttgatcttaataaattaaattatatgaac
gctcattatatcaaaaaggctgatcctgagcgcttgacggatctcgccctaccgtatttg
caagaggtaggaatcatccctcgcgaagaaatctcggacacggatcgagcttgggcgacc
cgctatgttcaagccatcatcaatcatctggattacctggctcaagtcaaggattatatt
cactatgtccgaggtggagaggctcctgctccggaaggtgaagccttagaaattctccaa
ggggaacaagtgacctctgtcttagacctttttgtagagaagttaaaaagcttagatgaa
atcacggtggatacggtcaagcccttgttcaagcaggtgacaaaagagttaaaattaggt
ggaaagcaagtctttatgccgattcgaattgctttgaccgggcaaatgcatggaccagag
ctttacgatatcgtacctctcttagggctggacaatgtaatgagtcgtttagaagggtcg
aagaagctgttgggataa

DBGET integrated database retrieval system