KEGG   Desulfitobacterium dichloroeliminans: Desdi_0805Help
Entry
Desdi_0805        CDS       T02390                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ddl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(835607..837460)
Genome map
AA seq 617 aa AA seqDB search
MCSILGLISFSRKLLPPDIQYLNQAGKTLAHRGPDQNGLSHREHFAFQHNRLAVIDLEKG
RQPMTTSHEGFEYTIVYNGELYNTEDLRQELRGYGVKFQTHCDTEVVLYSYIIWGEQCSA
KFNGIYAFVVYDSRQGRAYLARDRFGVKPFFYTFVDGALLFASELKAILQHPHVKAQLGY
EGLWQLLYMMPVKEEGTALFKNIFELPPASHAFFSPNSAGGPQGLQTTKYWSLAAYENRE
REDTIVATTRELLVDAIQRQLVADVPLCTFLSGGLDSSVITAVAAQSYQQKGAQLSTYSF
EHAGNKEHFQQTLFQPQSDDEYALYLADYLATQHQILTAQNEDLVNALNDAVRYRDYPGM
ADIDSSLLYYCRQVKKHHTVALSGECADEVFGGYPWFYRPEMLTSGFFPWIHDPYARISL
FRPEVVRPQAGFEYTSELYRQRVAACPVVAGESEAMRTSRIASWLSIHYFMTSLLERKDR
MSMASGLEVRVPFADHRLVDYVYNVPWDIKYKNGLEKSLLRAAMQDYLPDKILYRKKSPF
PKTHDPHYATLVYHLFQKRLSSGSGMLAELLHMDVLDRLASPGNNTWFGQLMGAPQLMAW
LVQLDFWFEEYKVELCL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccattctcggtttaataagtttttcgcgaaagctattacccccagatattcaa
tatcttaaccaagcagggaaaaccctagcccatcgggggccggatcaaaatgggctttct
catagggagcattttgcttttcaacataatcggttagccgtcattgaccttgaaaagggc
agacagcccatgacgaccagccacgaagggtttgaatataccatcgtctacaacggcgag
ctctataacactgaagatctacgtcaagagctacgcggttatggtgtcaagtttcaaacc
cattgcgatacggaagtggtgctgtacagctacatcatttggggtgagcaatgctccgcc
aagttcaacggcatttatgccttcgttgtttatgactccagacaaggccgagcctatctt
gcccgggaccgcttcggcgtcaagcccttcttctatacttttgtggacggcgccctactc
tttgcttcggagcttaaggcaatccttcagcatccccatgtaaaggctcagctgggttac
gaaggcttatggcagctgctctatatgatgcccgtcaaagaagaaggcaccgctcttttc
aaaaatatcttcgagcttcctcctgcctcccatgcgttcttctccccgaactctgcaggc
gggccacagggtttgcaaaccaccaagtactggtccttggcggcctacgaaaacagggag
agggaggacaccatcgtcgccaccacccgcgagcttctagtagatgccatccaacgtcag
ctggtcgccgatgtccccctctgcacctttctctcgggaggactggattcctcagttatt
acagcagtggccgcccaaagctatcagcaaaaaggtgcacagctctctacctactccttt
gaacacgccgggaataaagagcattttcagcaaaccctctttcagccgcaaagcgatgat
gaatatgccctctatctcgctgactacttggctacccagcatcagatcctcaccgctcaa
aacgaagatctggtcaacgctttaaatgacgcggtccgctatcgggattatcccggcatg
gcggacatcgactcttccctgctttactactgccgccaagtcaagaaacatcatacggtc
gccctctccggtgagtgcgctgacgaagtcttcggagggtatccttggttctatcgacct
gagatgctcacctccggattcttcccttggattcatgatccctatgcccgcattagctta
tttcgacctgaggtggttcgccctcaggcagggtttgaatatacctcagagctctatcgt
caaagggtggcggcctgtccggtggttgccggagaatcagaagcgatgcgcacctcgcgg
attgccagctggctttctatccactacttcatgacctcgctgctggaacgaaaggaccgc
atgagcatggcctccggactggaagtgcgggttccctttgctgatcatcggctggtcgac
tatgtctataacgtgccttgggatatcaaatacaaaaatggtttagaaaaatcactacta
cgtgctgccatgcaggattatctccccgataaaatcctttatcgaaaaaagagccccttc
cccaaaacccacgacccccactatgcaaccttggtctatcatcttttccaaaagcgttta
agctcgggcagtgggatgctggcggagctcttacacatggatgtgcttgatcgcctcgcc
agcccgggaaataacacctggtttgggcagctcatgggagcaccccagcttatggcttgg
ctggtccagctggatttttggttcgaggagtataaggttgagttatgcctgtaa

DBGET integrated database retrieval system