KEGG   Desulfitobacterium dichloroeliminans: Desdi_0879Help
Entry
Desdi_0879        CDS       T02390                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desdi_0879
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Desdi_0879
Enzymes [BR:ddl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desdi_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
910645..911889
Genome map
AA seq 414 aa AA seqDB search
MGIAIIVLVVGILYALTQGGNANNNGPSSNQQGGNNSSMLPSAPPKVDPIAEQLKEMSLE
EKVGQLVIVGTDGYEINENTQRLIQTYHVGGFILFQKNIRDTQQMLDLVNSLKKTNAINE
VPLFLALDEEGGRVSRMPAELRRMPSSQKVGKQNDSDLATRVGVVLGQELKVFGMNVNFA
PVLDIFSNPQNTVIGDRALGSTPELVSELGIQSMKGIQAQNIIPVVKHFPGHGDTTVDSH
VGLPKVDYDLERLQSFELIPFSEAIAHDADAIMLAHILIPQLDPEYPASLSKTLISDILR
EDMKFEGVVFTDDMTMGAILENYEIGEAAVKSLQAGSDIVLICHDFVQEEAALQAILAAA
RTGVISSDRIDESVYRVLALKKKYGLSNQSVESVDVQGINAEITKLYEDYPALR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttgggaattgccatcattgtccttgtcgtaggaattctgtatgccctcacccaaggggga
aatgcaaacaataacggcccctcgtctaatcagcagggagggaacaattcctctatgcta
ccgagcgctccgcccaaggttgaccccatcgccgaacagctgaaagagatgtccttagag
gaaaaagtaggacagctggtgattgttgggactgatggatatgagatcaatgaaaatacc
cagcggctgattcaaacctatcatgtgggtgggtttattctttttcagaaaaatatcagg
gatactcaacaaatgctcgatctcgtcaattccttaaagaagaccaatgccattaatgag
gttccgttgtttttagcccttgatgaggagggagggagagtttcccggatgcctgctgaa
ttgcggaggatgccttccagtcaaaaggtgggaaagcagaatgacagtgatttggcgacc
cgcgtaggagtagtcctgggccaagaacttaaggtcttcggtatgaatgttaatttcgct
cccgttttagatattttcagcaaccctcagaacacggttatcggggaccgggcattgggg
agtactcctgagctggtcagtgagctgggcattcagtcgatgaaggggatccaagctcaa
aacatcatccctgtggtcaagcattttccaggacatggagatactacggtggattctcat
gtgggtctacccaaagtcgattatgaccttgaacgcttgcaaagcttcgagttaattcct
ttttccgaggccatcgcccatgatgcggatgccattatgctggctcatatcctgatacca
cagcttgatcctgagtatcccgcgtcgctttcaaaaaccctgatctcggacattttacgg
gaagacatgaaatttgagggagtcgtcttcactgatgatatgaccatgggggcgatcctg
gagaattatgagattggcgaggcggcagtaaaatccctgcaagccgggagcgatatcgtt
ttgatttgtcatgactttgtacaagaagaagcggcattgcaggcgattctagcagcagcc
cggaccggggtaatatctagcgatagaatcgatgaaagcgtgtatcgggtgcttgctttg
aagaagaagtacgggctttccaatcagtctgtggaatccgtcgatgttcaaggaataaac
gctgaaatcacaaagctgtacgaggattatcctgcgctacgatag

DBGET integrated database retrieval system