KEGG   Desulfitobacterium dichloroeliminans: Desdi_0879Help
Entry
Desdi_0879        CDS       T02390                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ddl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
910645..911889
Genome map
AA seq 414 aa AA seqDB search
MGIAIIVLVVGILYALTQGGNANNNGPSSNQQGGNNSSMLPSAPPKVDPIAEQLKEMSLE
EKVGQLVIVGTDGYEINENTQRLIQTYHVGGFILFQKNIRDTQQMLDLVNSLKKTNAINE
VPLFLALDEEGGRVSRMPAELRRMPSSQKVGKQNDSDLATRVGVVLGQELKVFGMNVNFA
PVLDIFSNPQNTVIGDRALGSTPELVSELGIQSMKGIQAQNIIPVVKHFPGHGDTTVDSH
VGLPKVDYDLERLQSFELIPFSEAIAHDADAIMLAHILIPQLDPEYPASLSKTLISDILR
EDMKFEGVVFTDDMTMGAILENYEIGEAAVKSLQAGSDIVLICHDFVQEEAALQAILAAA
RTGVISSDRIDESVYRVLALKKKYGLSNQSVESVDVQGINAEITKLYEDYPALR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttgggaattgccatcattgtccttgtcgtaggaattctgtatgccctcacccaaggggga
aatgcaaacaataacggcccctcgtctaatcagcagggagggaacaattcctctatgcta
ccgagcgctccgcccaaggttgaccccatcgccgaacagctgaaagagatgtccttagag
gaaaaagtaggacagctggtgattgttgggactgatggatatgagatcaatgaaaatacc
cagcggctgattcaaacctatcatgtgggtgggtttattctttttcagaaaaatatcagg
gatactcaacaaatgctcgatctcgtcaattccttaaagaagaccaatgccattaatgag
gttccgttgtttttagcccttgatgaggagggagggagagtttcccggatgcctgctgaa
ttgcggaggatgccttccagtcaaaaggtgggaaagcagaatgacagtgatttggcgacc
cgcgtaggagtagtcctgggccaagaacttaaggtcttcggtatgaatgttaatttcgct
cccgttttagatattttcagcaaccctcagaacacggttatcggggaccgggcattgggg
agtactcctgagctggtcagtgagctgggcattcagtcgatgaaggggatccaagctcaa
aacatcatccctgtggtcaagcattttccaggacatggagatactacggtggattctcat
gtgggtctacccaaagtcgattatgaccttgaacgcttgcaaagcttcgagttaattcct
ttttccgaggccatcgcccatgatgcggatgccattatgctggctcatatcctgatacca
cagcttgatcctgagtatcccgcgtcgctttcaaaaaccctgatctcggacattttacgg
gaagacatgaaatttgagggagtcgtcttcactgatgatatgaccatgggggcgatcctg
gagaattatgagattggcgaggcggcagtaaaatccctgcaagccgggagcgatatcgtt
ttgatttgtcatgactttgtacaagaagaagcggcattgcaggcgattctagcagcagcc
cggaccggggtaatatctagcgatagaatcgatgaaagcgtgtatcgggtgcttgctttg
aagaagaagtacgggctttccaatcagtctgtggaatccgtcgatgttcaaggaataaac
gctgaaatcacaaagctgtacgaggattatcctgcgctacgatag

DBGET integrated database retrieval system