KEGG   Desulfitobacterium dichloroeliminans: Desdi_1235Help
Entry
Desdi_1235        CDS       T02390                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00340  Histidine metabolism
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01230  Biosynthesis of amino acids
Module
ddl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Desdi_1235
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Desdi_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGA68747
UniProt: L0F6D1
Position
1272885..1274165
Genome map
AA seq 426 aa AA seqDB search
MDIKTLEELDLSTLTRKSYGDDQLLEQNVAEIIARVRTEGDSALYDLTEKYDGVDLHSLG
LRVREEEITQAYSLVDEKFIEAIRLAKENIAAFHEKQKRNSWLDPKEDGSILGQLLLPLK
RVGVYVPGGTAAYPSSVLMNAVPAVVAGVEEIVMVTPPSKDGTLLPEVLVAAAEAGVTEI
YKVGGAQAIAALAFGTGEIASVDKITGPGNIFVTLAKKQVFGTVDIDMLAGPSEILILAD
DSARAEELAADLLSQAEHDPLASAILVSPDRQLLEKTVAEVERQLQELPRQGIARASWEN
YGAAILVKDLVEGMDLANEVAPEHFELVVREPYNWLGRVKNAGAVFLGRFSPEPVGDYFA
GPNHVLPTGGTARFYSPLNVDTFMKKVSVISYSEKALQRDGKHIAHLARKEGLEAHARAV
EVRKLW
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaaactctcgaggagctggatttatctaccctcacccgtaaatcttatggt
gatgatcaattgctggagcaaaatgtggctgagataattgcaagagtgcgcacagaggga
gattcagctctttatgacttaacggaaaaatatgatggagtggatctgcattctcttggc
ctgcgagtccgcgaagaagaaattactcaagcttactctttagttgatgagaaatttatc
gaggctattcgcctcgccaaggaaaatattgcagcatttcatgaaaaacaaaaacgtaat
tcttggcttgatcccaaggaagacggaagtatcttagggcaacttttgcttccccttaaa
cgagtgggcgtctatgttccaggtggaacggcagcttatccttcctcagtattgatgaat
gcggtgccagccgtggtcgccggggtggaggagatcgttatggtgactccacctagcaag
gatggcaccctcttaccggaggttttggtggccgcagccgaggccggagtcaccgaaatc
tacaaagtcggcggagctcaagccatagcggctttggcctttggtaccggagaaattgcc
tcagtggataaaatcaccgggcccggaaatatctttgtcaccttggccaagaaacaagtc
tttggaacggtggatattgatatgttggccggacccagtgagattttgattttggctgac
gattccgccagggcggaggagcttgccgcagatttgctctctcaggctgaacatgacccc
ttagcttccgccattttggtttcccctgatcgacaattactagagaagactgtggcggag
gtggagcgacagcttcaggagctacccaggcaagggattgctagagcttcctgggagaac
tatggggcagccattcttgtcaaggacttagtggagggaatggacttagcgaacgaagtt
gctccggaacacttcgagctagtagtgcgagagccgtataactggctgggcagagtaaag
aatgccggggcagtatttctgggacgattctcaccggaaccggtcggcgattactttgcc
gggccaaaccatgtcttgccaacgggaggaacagcccgtttttattcccccttaaacgtg
gatacctttatgaaaaaagtcagtgtgatcagttattcggaaaaggctttgcagcgagat
ggtaaacacatcgcccatctggctcgtaaagaagggcttgaggcacatgcccgggctgtg
gaggtaagaaaactatggtag

DBGET integrated database retrieval system