KEGG   Desulfitobacterium dichloroeliminans: Desdi_1486Help
Entry
Desdi_1486        CDS       T02390                                 

Definition
dTDP-4-dehydrorhamnose 35-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Desdi_1486
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desdi_1486
Enzymes [BR:ddl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Desdi_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512443..1512904
Genome map
AA seq 153 aa AA seqDB search
MITIEGVVTKRLVKHCDDRGFFTEILRDDDELLARFGQASLSMSYPGVIKAFHYHERQDD
LWFFPVGNAQVVLYDLRETSPTKGVTNVFYMGETNPLLLVIPKGVAHGYRVLGSNPLIIT
YFTTESYNPASPDERRLAWNDESINFDWITENR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgattacaattgaaggtgtagtaacaaagcgattagtcaaacattgtgatgaccgtggg
ttttttacggaaattctccgtgacgacgatgaactcttagcgcgttttggtcaggcatcc
ctttccatgtcttatccaggcgttattaaggcctttcattatcacgaacggcaggacgat
ttgtggtttttccctgtgggtaacgcccaggttgttttgtacgacttgcgagagacctcg
ccaactaagggtgtaaccaatgtgttttatatgggggagaccaatccattacttttagtt
attcctaagggagttgcccatggttatcgggttttaggatctaatcctctaatcattacc
tacttcaccaccgagtcttacaatccagccagccctgatgaacgaagactggcttggaat
gatgagagtattaactttgattggataaccgagaatcgttaa

DBGET integrated database retrieval system