KEGG   Desulfitobacterium dichloroeliminans: Desdi_1603Help
Entry
Desdi_1603        CDS       T02390                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ddl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1645948..1646769
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETIRRSLSLHVFNQCINEIEVRWPGAVEDYEGRTFAETVKGLRIQSIERRGKY
LLFTLDEGWSFIAHMRMTGRLVYHTQNHEPEKHTHVVLKLDQGEIHFTDTRKFGRLQLVR
TEERLNQSSLARLGPEPLEEDFTPDELGKRIAARKLAIKAALLDQSLVAGIGNIYADESL
FRAGIAPERCANTLTNEEVESLYRAIREVLQEGIDAKGTSFRDYQDANGNKGNFQKELKV
YGRGGEACRCCGQPLERIRLGGRSTVFCSSCQK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattaccggaagtagagacgattcgccgcagcttaagtctgcatgttttcaac
cagtgtatcaatgagattgaggttcgctggccgggcgctgtggaggattatgagggaaga
acctttgctgaaacagtcaaagggctgaggattcaaagtatcgaacgacgtgggaaatat
ctattgtttactttggatgaaggatggtccttcattgcccatatgcggatgaccggacgc
ctggtataccatacacaaaaccatgaaccagagaaacatacccacgtcgtcttaaagctt
gaccaaggggaaattcatttcaccgatacgcgaaagtttggccggttacagctagtaaga
acagaggaacggctcaaccaatcctccttagctcgtttggggccggagccattagaggaa
gattttacacccgatgagctcggaaaacgaatcgccgcgcgaaaactagcgatcaaggca
gctttattggatcaatccttagtggcgggaattgggaatatctacgctgatgagtcgttg
tttagggccgggattgcccctgaacgctgtgccaacaccctgactaatgaagaagtggag
agtctctatagggcaatccgtgaagtccttcaagaaggaattgacgccaagggtacctcc
tttcgtgattatcaggatgccaatggtaataagggaaactttcaaaaggagctaaaggtc
tatggccgcggaggggaagcctgtcgatgttgcgggcaaccgttagaaaggattcgactt
ggaggccgttccacagtattttgttcaagctgtcagaagtag

DBGET integrated database retrieval system