KEGG   Desulfitobacterium dichloroeliminans: Desdi_1626Help
Entry
Desdi_1626        CDS       T02390                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ddl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671460..1672572
Genome map
AA seq 370 aa AA seqDB search
MSDFRRIVIKIGSSSLNHPEGGLDDQAIDRIAQLVAEIRKFGVECVLVSSGAVAAGVGKL
NLKSRPKNVAGKQAVAAVGQGVLIEKYALALEAHGLVCAQVLLSRIDLAEASRYRNAQNT
LEQLLRFHVVPIINENDTVAVEELCFGDNDRLSALVAGLVHGDLLVILTDVEGLYSANPK
LDPEAKLITEVKDLSEVVGVAGGPGSSLGTGGMLTKIKAAEIATRFGIGMFLLHSRHMED
ITKLIQGERPLGTYFLPAEHRIMGRKRWIAYGGLSEGSIFIDQGAVNALLTGKSLLASGI
TGLEGTWERKELVRINSPEGIEVARGLVELNSDELEKVRGKHSDVMLDLIPNLEGKEVVH
RDNMTMMLEC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgattttcggcggattgtcataaaaattggaagtagtagcttaaaccaccctgaa
ggtggccttgatgatcaagcaattgatagaattgctcaattggttgctgagattcgtaag
ttcggagtggaatgcgtcctagtcagctcgggtgcagtggctgccggtgtcgggaaactg
aatttaaagtctagacctaagaacgtagcaggtaaacaggctgtggctgctgttggtcaa
ggggttctcatcgagaaatacgctcttgctctagaagcccatggtctagtctgtgctcag
gttttactttcacgaatcgacctggctgaagcttcacgctatcggaatgcacagaatacc
ttggaacaattgctccgctttcacgtcgttccgattatcaatgaaaatgatacggttgct
gttgaggaactttgttttggggataatgaccgcctttcggcacttgtggcagggctggtt
cacggagatttgctggtaatactcacggatgtggagggtctttattctgccaaccctaaa
ctggatcctgaggccaagctcattacggaagttaaagatctttccgaagttgtgggggtg
gctggtggaccgggtagctccttaggaaccggtggaatgcttacgaagattaaagctgcg
gagatcgctacccgttttggtatcggtatgttccttcttcactccagacatatggaggat
attactaagcttattcagggagaacgtccccttggtacttattttctaccagctgagcat
cgcattatgggaagaaaacgttggattgcctatggagggctttcagaaggaagcattttt
attgaccaaggggcagtcaatgctttgcttacaggaaagagtttactagcttccggtatc
acgggactagaaggaacctgggagcgcaaggagctagttcgtatcaatagtccagagggg
attgaagtcgcccgaggactcgtggagctaaacagtgatgaactagaaaaagtacggggg
aaacattcagatgtgatgttagacttaatcccgaatttggagggtaaagaggtcgtgcat
cgtgacaatatgacgatgatgctggaatgttag

DBGET integrated database retrieval system