KEGG   Desulfitobacterium dichloroeliminans: Desdi_1802Help
Entry
Desdi_1802        CDS       T02390                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00010  Glycolysis / Gluconeogenesis
ddl00020  Citrate cycle (TCA cycle)
ddl00620  Pyruvate metabolism
ddl00633  Nitrotoluene degradation
ddl00640  Propanoate metabolism
ddl00650  Butanoate metabolism
ddl00680  Methane metabolism
ddl00720  Carbon fixation pathways in prokaryotes
ddl01100  Metabolic pathways
ddl01120  Microbial metabolism in diverse environments
ddl01130  Biosynthesis of antibiotics
ddl01200  Carbon metabolism
Module
ddl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desdi_1802
   00020 Citrate cycle (TCA cycle)
    Desdi_1802
   00620 Pyruvate metabolism
    Desdi_1802
   00640 Propanoate metabolism
    Desdi_1802
   00650 Butanoate metabolism
    Desdi_1802
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desdi_1802
   00680 Methane metabolism
    Desdi_1802
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desdi_1802
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desdi_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AGA69252
UniProt: L0F7S7
Position
1824588..1824866
Genome map
AA seq 92 aa AA seqDB search
MALKELPVVPSGDPGSLAESPNSAIQRIYRPVIKDQTQVNPIVLLFCPDGALSLIGDEIV
VSYQHCKGCGICAKESKGIEMVPEYTGPRGFF
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaggagctacctgttgtaccatcaggtgacccaggttccttggcagaatca
ccgaactcagccattcagcgtatttatcgtccagtgataaaagatcagacccaagtcaac
cccattgttttacttttttgtccagatggagctctttctttgataggggatgagatcgta
gtcagctatcaacattgcaagggttgcggtatctgtgccaaggaaagtaaaggaattgag
atggtgccggaatatacgggaccacggggatttttttag

DBGET integrated database retrieval system