KEGG   Desulfitobacterium dichloroeliminans: Desdi_1804Help
Entry
Desdi_1804        CDS       T02390                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desdi_1804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desdi_1804
   00020 Citrate cycle (TCA cycle)
    Desdi_1804
   00620 Pyruvate metabolism
    Desdi_1804
   00640 Propanoate metabolism
    Desdi_1804
   00650 Butanoate metabolism
    Desdi_1804
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desdi_1804
   00680 Methane metabolism
    Desdi_1804
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desdi_1804
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desdi_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826051..1826908
Genome map
AA seq 285 aa AA seqDB search
MIDFKELPKEELFGQGNVGCKGCGAAIAGRQAMKVLGERTIITIPASCMATLGGNNTKTT
WRVPFYHTLFECAPAISSGIRAALEIQGIKDVNVVSWGGDAGSADIGFQSLTGAAERQEH
MIHVLYDNEMYMNTGGQTGSQTPLYAITSNSALGKPVHKKNMLAIMEAHGIDYVASANIA
YPEDLMAKFKKAAAKKGFSYIHILAPCHRGWQIKPEETIEISRKATECGLWELFEVDEGK
RTQTYEPSFTPVADYLKSQGRFKNLSDEQISSFQKSVDSYYKRGE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttaaggaacttccgaaagaagaactctttggacagggtaatgtaggatgt
aaaggatgcggagcagcaattgctggtcgacaagctatgaaggttctcggggaacggaca
attatcacaattccggcatcttgtatggccaccctcggtgggaataataccaaaacaacg
tggcgagtgcctttctaccataccctgtttgagtgtgctccggcaatatcctctggaatt
agagctgctctagaaatccaggggattaaggatgtcaatgtcgtatcatggggcggcgat
gcagggagtgccgatattgggttccaatccctcacaggtgccgctgagcgccaagaacac
atgattcacgttctttatgataatgaaatgtatatgaatacaggcggtcaaaccggcagc
caaacccctctgtacgctattaccagtaatagcgctttagggaaaccagttcataagaag
aacatgcttgctattatggaagctcatggtattgattatgtcgctagtgcgaacatcgca
taccctgaagatcttatggctaagttcaaaaaagctgccgctaagaagggattctcctat
attcatattctagccccttgccaccgcggctggcagattaagcctgaagaaaccattgaa
atctccaggaaggcaaccgaatgcggactctgggaactttttgaagtggatgaaggaaaa
cgaacccagacttatgaaccaagttttactccagtagcagattatcttaaatcccaaggt
cggtttaaaaatttaagcgatgagcaaatctcaagttttcaaaaatctgtggattcctat
tacaagcggggggagtga

DBGET integrated database retrieval system