KEGG   Desulfitobacterium dichloroeliminans: Desdi_1805Help
Entry
Desdi_1805        CDS       T02390                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desdi_1805
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desdi_1805
   00020 Citrate cycle (TCA cycle)
    Desdi_1805
   00620 Pyruvate metabolism
    Desdi_1805
   00640 Propanoate metabolism
    Desdi_1805
   00650 Butanoate metabolism
    Desdi_1805
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desdi_1805
   00680 Methane metabolism
    Desdi_1805
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desdi_1805
Enzymes [BR:ddl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desdi_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826914..1827336
Genome map
AA seq 140 aa AA seqDB search
MVEVKLLGRFGQPVGKITRAMGKQLMTEGKHVQVFDGFGAFRPGNLTNSTLRVADEVIIE
RSENETTPDVIVVLDNSLFAVSDVTKGLKPKGKVIALGVTKDVLGEKAQDVTFIAVDPSF
KGGADCEDELIKVLKQHSVL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaagtaaaattattgggacgctttgggcaacccgtagggaaaattacacgagca
atggggaaacagcttatgaccgaaggaaagcatgtccaagtctttgacggatttggagca
ttccgaccgggaaatctcacgaactccacccttagagttgctgatgaggtcattattgag
cgctcagagaatgagaccaccccagatgtcatcgtcgtactagataacagcttatttgca
gtaagtgatgtaaccaaaggactaaaacccaaaggtaaggtaatcgccttaggagtaacc
aaggatgtcctaggagaaaaggctcaagacgttacttttatcgcagtagacccaagcttc
aaaggtggagcagattgcgaagacgaattgatcaaagttctcaagcaacatagtgtgtta
taa

DBGET integrated database retrieval system