KEGG   Desulfitobacterium dichloroeliminans: Desdi_1891Help
Entry
Desdi_1891        CDS       T02390                                 

Definition
(GenBank) peptidase family protein
Organism
ddl  Desulfitobacterium dichloroeliminans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1917621..1918664)
Genome map
AA seq 347 aa AA seqDB search
MPYNQNPLDYSLLERLTQTFGPSGVEEKVTSAIADEVRPYCDEMKTDTLGNLIAIRRGTG
KKIMIAAHVDEIGVMITHIDEKGYLRFAPIGGISIRELPHRRVLFQSGRWGTIGVEKLEK
PIDLKLDKLYIDIGATSQEEAKTHVSIGESAVFAGNFIKQEKRITAKAMDDRVGCFVAIE
VMKRLKSNHEIYFVFTVQEEVGTRGAQIAAFALEPDLAIALDVTGTGDTPKAHPMDVKLG
HGAAIKVFDRSMITHPKIKSWMADTAEQYNIPYQWEVLEYGGTDSGAIHLSKGGIPSGVI
SIPTRYIHSPSETVDQGDIEGAVQLLLALLEGPAELAMMQGSARAPY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccctataatcagaatcctctggattattcattattggaacggttaacccaaaccttt
ggaccctctggtgttgaagaaaaagtgacttcagctattgctgatgaggttcgcccttac
tgtgatgagatgaagacagataccctaggtaatctgatcgccatccgtcgtgggactggc
aagaaaattatgattgctgcccatgtggacgaaatcggggtcatgattacgcatatcgat
gagaagggctatttgcgcttcgcaccaataggtggtatctccatacgtgaattgccccat
cgtcgagttctgtttcaaagcggtagatggggaaccattggggtcgaaaaattagagaag
cccatcgatcttaaactggataagctctatattgatatcggtgctacttctcaagaagaa
gccaaaactcatgtgtctatcggggaaagtgctgtttttgccggaaacttcattaagcaa
gaaaagcggataaccgccaaggcaatggatgatcgagtaggatgctttgtggctatcgaa
gtgatgaaacgcctgaagagcaatcatgaaatttattttgtatttactgtccaagaagag
gtagggacccgcggtgcccaaatagctgcttttgccctcgaacccgatttagctattgcc
ttggatgtcacggggactggagatacccccaaagcgcaccccatggatgtgaaactaggt
catggtgctgccattaaagtattcgaccgctcgatgattactcatccaaaaatcaaatct
tggatggctgatactgctgagcaatataatatcccttatcagtgggaggttctcgaatac
ggtggtaccgattccggagccatccatttgagcaagggagggattccatcaggcgttata
tctatccctacccgttatatccatagcccctctgagaccgtagatcaaggagatatcgaa
ggggctgtccaactgctgctagctctattggaaggccctgcagagctagctatgatgcaa
gggagcgctcgcgctccgtattaa

DBGET integrated database retrieval system