KEGG   Desulfitobacterium dichloroeliminans: Desdi_1892Help
Entry
Desdi_1892        CDS       T02390                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1918678..1919694)
Genome map
AA seq 338 aa AA seqDB search
MLLKALTQLNGTSGAEQEIRTTLTEELRPFVSSIQTDKIGNLIVQKNSLSTGPKVMIAAH
MDEVALMITAITSEGFLKFKPVGGIDSRILVSKPVQINSLLGVIGAKAIHLQKPKEREQA
LKIEQLYIDIGATAKEEAEKHVKIGDYAYFYTETESLGEGYWKGKAFDDRVGCTLLAELL
KKDYPLNLIGAFTVQEEVELRGSAIAAFHVQPDLAIILEGTISAHMMEVEEGAWVTEPGK
GPALSIMDSATLYQPKLLQQVTELADKNGIPYQFRKGHNGGNDAGSIHLSREGIPTIAIS
VPCRYIHSTASVMAEADLQNALKLVDIILKSIPNEFKF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctattaaaggccttaacccagctcaacggaacctcaggagctgaacaggaaatccgc
actactctcacggaagaactgagaccctttgtaagttccatacagaccgataagattggc
aacctcattgtccaaaagaactcgctatcaaccggtccaaaagtaatgatagccgctcat
atggatgaggtagcgcttatgattacagcgattacctccgaaggatttcttaagtttaag
ccagttggcggtattgactcaagaatcctcgtctccaagcccgtgcaaatcaattctttg
ctgggggttattggggcgaaggctattcaccttcagaaacccaaggaacgtgagcaggcc
ttgaaaattgaacagctctatatcgatatcggtgctacagccaaggaagaagctgaaaaa
catgtcaaaataggagattatgcctacttctatacagaaaccgagtccttaggtgaaggg
tattggaaaggcaaagcttttgacgatcgagtcggctgtactcttctcgctgagctctta
aagaaagattatccccttaacctcattggtgccttcacagttcaagaggaagtggagtta
agaggatctgccattgcggccttccatgtgcaaccggatttggccatcattctcgaaggt
accatttctgctcatatgatggaagtagaagagggtgcctgggttacggaaccgggaaag
gggccggctctttccattatggatagtgccaccttgtatcaacctaagcttcttcaacaa
gtgacagaactcgcggataaaaatggcattccttatcaatttcgaaaagggcataacggt
ggcaatgatgccggctctattcatctaagccgcgagggaattcccacaatcgccatcagt
gttccttgtcgttatattcactctaccgcatcggttatggctgaagcagatttgcaaaat
gctctgaaattagtagatataatcctcaagtctattcccaatgaatttaagttttaa

DBGET integrated database retrieval system