KEGG   Desulfitobacterium dichloroeliminans: Desdi_2056Help
Entry
Desdi_2056        CDS       T02390                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2105690..2106262)
Genome map
AA seq 190 aa AA seqDB search
MENLSIDLEKIEEAVKMILDAIGEDPQREGLLDTPKRVARMYQEVFSGIHEDPSQHLKVQ
FSEDHEEMIIVKDIPVYSMCEHHLVPFYGKAHVAYIPRKGKITGLSKIARVVEGYAKRPQ
LQERLTGQVADSVMSMLNARGVLVVIEAEHMCMTMRGVKKPGSRTLTSAVRGIFKTNEVT
RAEGFALIKQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacttgagtattgatttagaaaagattgaagaagcggtaaagatgattctggat
gcgattggcgaagatccccaacgggaaggattattagacacgcccaaacgagttgcccga
atgtatcaagaggtcttttccggaattcatgaggatcccagccaacatttaaaggtgcag
ttctccgaagatcatgaagaaatgatcattgtcaaggatattccggtgtattctatgtgt
gaacatcatcttgttcccttctatggtaaagcccatgtggcctacatacctcgcaaagga
aagattacaggtttgtcaaagattgctagggtagttgaagggtatgctaaacgaccgcag
ctacaagagcgtttaactgggcaggttgcggactccgtgatgagtatgctcaatgccaga
ggggtacttgtcgtcattgaagcagaacatatgtgtatgaccatgcgcggagttaaaaaa
ccgggttcacggaccttgacttctgcagtacgggggatttttaaaaccaatgaagtgact
cgtgccgaagggtttgcgctcataaagcaataa

DBGET integrated database retrieval system