KEGG   Desulfitobacterium dichloroeliminans: Desdi_2128Help
Entry
Desdi_2128        CDS       T02390                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00260  Glycine, serine and threonine metabolism
ddl00750  Vitamin B6 metabolism
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01120  Microbial metabolism in diverse environments
ddl01230  Biosynthesis of amino acids
Module
ddl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desdi_2128
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desdi_2128
Enzymes [BR:ddl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desdi_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AGA69569
UniProt: L0F6Y2
Position
complement(2172019..2173494)
Genome map
AA seq 491 aa AA seqDB search
MYESTRGNYPEQTGKEAIALGMVPVGGLFVPKHYPKINWEDIRGITYPQLAQLIFQSYLP
DFTKEKCIEASEIYNKNVFDSDNPAPLVNVGKMGILELWHGPTAAFKDMALQVLPHLLGE
SMKVLTQTDRVLILVATSGDTGKAALEGFKNVKGTEIIVFYPESGVSTVQERQMTTTDGV
NTRVVPVMGNFDQCQSAVKEIFANSKLRETFNQRGIAFSSANSINWGRLLPQIVYYFWAY
LQAVESQSLRPGEKMNVVVPTGNFGNILAAYYARMMGLPINKLICASNENNVLTDFFVEG
IYNRNRSFYVTSSPSMDILISSNFERFLYEMSGKRPDKINNWYKQLQERGEFKVDSDTLA
MAREAVVAGWASEAEVQMVIKAVYQEYSYVLDPHTAVAVKVYDDYTKKTGDKTFTIIAST
ASPFKFAKTVLEGIDASAVSGDEWINLKKLSEITGWAIPQGLQGLEDKQTFGLSHVRPKE
ISELIRKVYIS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaagcactagaggaaactatccggaacaaacaggaaaagaagccattgccttg
ggtatggttccggtgggaggattatttgttccaaagcattaccctaaaatcaactgggaa
gacattcgcggaataacctatccgcagcttgcccaattgatttttcaatcctatcttccc
gattttacgaaagaaaaatgtattgaggcttcagaaatatataataagaatgtctttgat
tctgataatcccgcaccattggtaaacgtagggaagatgggaatactggaattatggcat
ggacctactgctgcctttaaggatatggcgttacaagttctgccccatttacttggagaa
agtatgaaggttttaacccaaacagatagagtcctgattcttgtagctacttcgggtgat
accggcaaggctgccttggaaggctttaagaatgtaaagggcacagagattatagtcttt
tatcccgagagtggcgtcagcaccgttcaagagcggcaaatgaccacaactgatggagtg
aatacccgagtggttcccgtcatgggcaactttgaccaatgtcaatccgcagtaaaggag
atcttcgccaattcaaaattgagagaaacctttaatcaacgggggatcgctttttcttca
gctaattcaatcaactggggtaggctcttgccgcaaatcgtctattatttttgggcttat
ctacaagcagtggagtcccaatcacttcgtcccggagaaaagatgaatgtggttgtgccc
acgggtaactttggtaatatccttgcagcctattatgccaggatgatggggttaccgatt
aataaactgatttgtgcctccaatgagaataatgttttgacggatttctttgttgaggga
atctacaatcgtaatcgatctttttatgtgacctcctcgccatcgatggatatcttgata
tccagcaacttcgaacgctttttgtatgagatgtcggggaaaagaccggataaaatcaac
aattggtataaacaacttcaggaacgaggtgaattcaaggttgattccgacacactggcc
atggcaagggaggcagttgttgccggctgggccagtgaagcagaggttcagatggtcatt
aaggctgtctaccaagaatactcttatgtcttagatcctcatactgccgttgccgtgaaa
gtatacgatgattatacgaagaagacgggtgataagacatttacaatcattgcttcaacg
gcaagcccgttcaaatttgctaaaactgttcttgagggcatcgatgccagtgctgtatca
ggggatgaatggattaatttaaagaagctgagtgagatcaccggttgggcgattccccaa
ggacttcagggattagaggataaacaaacctttggtctgagccacgtcagaccaaaagag
atttctgagctgattagaaaagtttatatatcttaa

DBGET integrated database retrieval system