KEGG   Desulfitobacterium dichloroeliminans: Desdi_2128Help
Entry
Desdi_2128        CDS       T02390                                 

Definition
(GenBank) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desdi_2128
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desdi_2128
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desdi_2128
Enzymes [BR:ddl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desdi_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2172019..2173494)
Genome map
AA seq 491 aa AA seqDB search
MYESTRGNYPEQTGKEAIALGMVPVGGLFVPKHYPKINWEDIRGITYPQLAQLIFQSYLP
DFTKEKCIEASEIYNKNVFDSDNPAPLVNVGKMGILELWHGPTAAFKDMALQVLPHLLGE
SMKVLTQTDRVLILVATSGDTGKAALEGFKNVKGTEIIVFYPESGVSTVQERQMTTTDGV
NTRVVPVMGNFDQCQSAVKEIFANSKLRETFNQRGIAFSSANSINWGRLLPQIVYYFWAY
LQAVESQSLRPGEKMNVVVPTGNFGNILAAYYARMMGLPINKLICASNENNVLTDFFVEG
IYNRNRSFYVTSSPSMDILISSNFERFLYEMSGKRPDKINNWYKQLQERGEFKVDSDTLA
MAREAVVAGWASEAEVQMVIKAVYQEYSYVLDPHTAVAVKVYDDYTKKTGDKTFTIIAST
ASPFKFAKTVLEGIDASAVSGDEWINLKKLSEITGWAIPQGLQGLEDKQTFGLSHVRPKE
ISELIRKVYIS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaagcactagaggaaactatccggaacaaacaggaaaagaagccattgccttg
ggtatggttccggtgggaggattatttgttccaaagcattaccctaaaatcaactgggaa
gacattcgcggaataacctatccgcagcttgcccaattgatttttcaatcctatcttccc
gattttacgaaagaaaaatgtattgaggcttcagaaatatataataagaatgtctttgat
tctgataatcccgcaccattggtaaacgtagggaagatgggaatactggaattatggcat
ggacctactgctgcctttaaggatatggcgttacaagttctgccccatttacttggagaa
agtatgaaggttttaacccaaacagatagagtcctgattcttgtagctacttcgggtgat
accggcaaggctgccttggaaggctttaagaatgtaaagggcacagagattatagtcttt
tatcccgagagtggcgtcagcaccgttcaagagcggcaaatgaccacaactgatggagtg
aatacccgagtggttcccgtcatgggcaactttgaccaatgtcaatccgcagtaaaggag
atcttcgccaattcaaaattgagagaaacctttaatcaacgggggatcgctttttcttca
gctaattcaatcaactggggtaggctcttgccgcaaatcgtctattatttttgggcttat
ctacaagcagtggagtcccaatcacttcgtcccggagaaaagatgaatgtggttgtgccc
acgggtaactttggtaatatccttgcagcctattatgccaggatgatggggttaccgatt
aataaactgatttgtgcctccaatgagaataatgttttgacggatttctttgttgaggga
atctacaatcgtaatcgatctttttatgtgacctcctcgccatcgatggatatcttgata
tccagcaacttcgaacgctttttgtatgagatgtcggggaaaagaccggataaaatcaac
aattggtataaacaacttcaggaacgaggtgaattcaaggttgattccgacacactggcc
atggcaagggaggcagttgttgccggctgggccagtgaagcagaggttcagatggtcatt
aaggctgtctaccaagaatactcttatgtcttagatcctcatactgccgttgccgtgaaa
gtatacgatgattatacgaagaagacgggtgataagacatttacaatcattgcttcaacg
gcaagcccgttcaaatttgctaaaactgttcttgagggcatcgatgccagtgctgtatca
ggggatgaatggattaatttaaagaagctgagtgagatcaccggttgggcgattccccaa
ggacttcagggattagaggataaacaaacctttggtctgagccacgtcagaccaaaagag
atttctgagctgattagaaaagtttatatatcttaa

DBGET integrated database retrieval system