KEGG   Desulfitobacterium dichloroeliminans: Desdi_2158Help
Entry
Desdi_2158        CDS       T02390                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
ddl00020  Citrate cycle (TCA cycle)
ddl00640  Propanoate metabolism
ddl00660  C5-Branched dibasic acid metabolism
ddl00720  Carbon fixation pathways in prokaryotes
ddl01100  Metabolic pathways
ddl01110  Biosynthesis of secondary metabolites
ddl01120  Microbial metabolism in diverse environments
ddl01130  Biosynthesis of antibiotics
ddl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desdi_2158
   00640 Propanoate metabolism
    Desdi_2158
   00660 C5-Branched dibasic acid metabolism
    Desdi_2158
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desdi_2158
Enzymes [BR:ddl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desdi_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AGA69599
UniProt: L0F704
Position
complement(2199922..2201199)
Genome map
AA seq 425 aa AA seqDB search
MARFLEYQGKDWLAKAGMPVPKGRPASTPEEAKEIAEWIGGPVAVKGQVQAGGRGKAGIV
KLVNTPEEAAAVAAEILSKTVNGLPVRKVLVEEKLDIKKEFYCSFVVNGAREARSPMLMF
SLEGGMDIESVPEEKLLKINVDPLTGLQSYDAVDLAAKAGVAPEDLSKFAKFLTKLSQTY
KKYDCMTLEINPFIMTGKGDLICADCKMEIDNSSVGRHPEFGFDIARDLPGEPTELDYIG
WSIEETDARGTGFLMNMGYDEVSPGHIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVASKIYRVAKSVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKHGLPCVL
LLCGNREDESLEILRTGLADLMTADGPGKRIEIYGKQYVTDTKFIGERLLALSKEYRAEK
EAQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttctagagtatcaaggtaaagattggcttgcaaaagcaggaatgccggta
cctaagggtcgtccggcatcgacccccgaagaagcaaaggaaatcgccgagtggattggc
ggacctgtagctgtcaaaggtcaggtacaagcgggtggtcgtggtaaagcagggattgtt
aaacttgttaacactcctgaagaagcagcagctgttgctgcagagattctctctaagacg
gtaaatggcctaccggtgcgtaaagttcttgtggaagaaaagctcgatatcaaaaaagaa
ttctattgctcctttgtcgttaatggtgcaagagaagctcgttccccaatgctcatgttc
agtcttgagggcggaatggatatcgaaagtgttcctgaagaaaagctgcttaagatcaat
gttgatcctctcactggattgcaatcttatgatgcagtggatttagctgcaaaagccggc
gttgctcctgaagacttaagcaagttcgcaaaatttttgacgaaactttcccaaacgtac
aagaaatatgattgcatgaccctagaaattaatccttttattatgacaggtaagggtgat
cttatctgtgctgactgtaagatggaaatcgacaacagttcagttggtcgtcacccagag
ttcggttttgatattgctcgtgacctgccgggagagcctacagagctcgactatattggt
tggagtatcgaagagaccgatgctcgtggaacagggttcctaatgaacatgggctatgac
gaagtcagcccaggccatatcggctatcaccccattggtggtggttcagctatgatggga
cttgacgcgctgaatcaagttggtttaaaacctgctaactatgctgatacaagcggaaac
ccagtagcatcaaagatctaccgagtggcaaaatcagtgctttctcagccgaatattgat
ggttatctcctcggtggcttcatgatggccaatcaggagcaatggcatcatgctcatgct
atcgtaaaagttcttcgtgaaattcttccaacccagaaacatggactaccctgtgttctc
ctcctctgcgggaacagggaagatgaatctctggaaattcttcgcactggacttgctgat
ttaatgactgctgatggtcctggtaagagaatcgagatttatggtaaacaatatgttacc
gatacgaagttcattggtgaaagactcttagctctgagcaaggaatatagagctgagaaa
gaagctcaaggaaagtag

DBGET integrated database retrieval system