KEGG   Desulfitobacterium dichloroeliminans: Desdi_2158Help
Entry
Desdi_2158        CDS       T02390                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ddl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ddl00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ddl00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:ddl00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:ddl00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199922..2201199)
Genome map
AA seq 425 aa AA seqDB search
MARFLEYQGKDWLAKAGMPVPKGRPASTPEEAKEIAEWIGGPVAVKGQVQAGGRGKAGIV
KLVNTPEEAAAVAAEILSKTVNGLPVRKVLVEEKLDIKKEFYCSFVVNGAREARSPMLMF
SLEGGMDIESVPEEKLLKINVDPLTGLQSYDAVDLAAKAGVAPEDLSKFAKFLTKLSQTY
KKYDCMTLEINPFIMTGKGDLICADCKMEIDNSSVGRHPEFGFDIARDLPGEPTELDYIG
WSIEETDARGTGFLMNMGYDEVSPGHIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVASKIYRVAKSVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKHGLPCVL
LLCGNREDESLEILRTGLADLMTADGPGKRIEIYGKQYVTDTKFIGERLLALSKEYRAEK
EAQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttctagagtatcaaggtaaagattggcttgcaaaagcaggaatgccggta
cctaagggtcgtccggcatcgacccccgaagaagcaaaggaaatcgccgagtggattggc
ggacctgtagctgtcaaaggtcaggtacaagcgggtggtcgtggtaaagcagggattgtt
aaacttgttaacactcctgaagaagcagcagctgttgctgcagagattctctctaagacg
gtaaatggcctaccggtgcgtaaagttcttgtggaagaaaagctcgatatcaaaaaagaa
ttctattgctcctttgtcgttaatggtgcaagagaagctcgttccccaatgctcatgttc
agtcttgagggcggaatggatatcgaaagtgttcctgaagaaaagctgcttaagatcaat
gttgatcctctcactggattgcaatcttatgatgcagtggatttagctgcaaaagccggc
gttgctcctgaagacttaagcaagttcgcaaaatttttgacgaaactttcccaaacgtac
aagaaatatgattgcatgaccctagaaattaatccttttattatgacaggtaagggtgat
cttatctgtgctgactgtaagatggaaatcgacaacagttcagttggtcgtcacccagag
ttcggttttgatattgctcgtgacctgccgggagagcctacagagctcgactatattggt
tggagtatcgaagagaccgatgctcgtggaacagggttcctaatgaacatgggctatgac
gaagtcagcccaggccatatcggctatcaccccattggtggtggttcagctatgatggga
cttgacgcgctgaatcaagttggtttaaaacctgctaactatgctgatacaagcggaaac
ccagtagcatcaaagatctaccgagtggcaaaatcagtgctttctcagccgaatattgat
ggttatctcctcggtggcttcatgatggccaatcaggagcaatggcatcatgctcatgct
atcgtaaaagttcttcgtgaaattcttccaacccagaaacatggactaccctgtgttctc
ctcctctgcgggaacagggaagatgaatctctggaaattcttcgcactggacttgctgat
ttaatgactgctgatggtcctggtaagagaatcgagatttatggtaaacaatatgttacc
gatacgaagttcattggtgaaagactcttagctctgagcaaggaatatagagctgagaaa
gaagctcaaggaaagtag

DBGET integrated database retrieval system