KEGG   Desulfitobacterium dichloroeliminans: Desdi_2207Help
Entry
Desdi_2207        CDS       T02390                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desdi_2207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desdi_2207
   00052 Galactose metabolism
    Desdi_2207
   00500 Starch and sucrose metabolism
    Desdi_2207
   00520 Amino sugar and nucleotide sugar metabolism
    Desdi_2207
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desdi_2207
   00524 Butirosin and neomycin biosynthesis
    Desdi_2207
Enzymes [BR:ddl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desdi_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2252440..2253468
Genome map
AA seq 342 aa AA seqDB search
MPYDKTDKGNPLYLAGDIGGTKTLLGLYSLKGTELTLVRERKSSSRDWQRLTPFIQGFLE
EMALTPEDITGACLSLAGPLTQERCLLTNLNKVIHFQSLHSTLHFQRPLLFVNDLEAMGQ
GLLVSQKEDLLCLNSRAQNSISAPAIPSPNRALLAPGTGLGQAMILGNHQIYATEGAHRD
YAPRTEQEIRLWRFLAQKYDHVSYERILSGPGLATIYHFLRWEAHPHSLHDPVPASEQIT
KRALAGICPLCTETLELFVKILGAEAGNLALMTLAYGGIYLGGGIPPKILPKLQEDDFME
AFLAKGRFRDLLSSIPIYVILNEKTPLLGAARLAAAAEYPIA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttatgataaaacagataaaggtaatcccttatatctggccggcgacattggcgga
acaaaaactctcttagggctttattccctcaagggcaccgagctcaccttagttagagaa
agaaaatcctccagcagggactggcaaaggttaacaccattcattcaaggatttttagaa
gagatggcactcacacccgaagacataaccggggcctgcctcagtctcgccggacccctt
actcaggaaaggtgtctgctcaccaatttgaacaaggttattcatttccaatccttgcat
tccactcttcattttcaaaggccactgctttttgtcaacgaccttgaggctatgggacag
ggcctattagtttcacaaaaagaggatttgttatgtcttaactctagggcacaaaactcc
atctccgcccccgctataccttctccaaatcgggcactgcttgcccctggcaccggcctg
ggtcaggccatgatcctaggcaatcaccagatctatgccacagaaggggcgcatagagat
tatgctccccgcacagaacaggaaatacggttgtggcgttttttagcgcaaaaatatgat
catgtcagctacgaaagaattctatccggtcccggactggcaaccatctatcattttcta
cgctgggaagcccatccccattctctccatgaccccgtccctgcttctgaacagattaca
aaaagagccctagccggaatctgtccactctgtacagaaacactagaactctttgttaaa
atcctgggtgcagaagcaggcaatctcgctttaatgaccctggcctatgggggaatatat
ctgggcgggggcatcccccccaaaattcttcccaagctacaagaggatgacttcatggag
gcctttctcgccaaagggcgttttagggatcttctttcctccattcccatttatgtgatt
cttaatgaaaagacgcctttgctgggagcagcccgcctggcggcagcagccgaatatcct
atagcttaa

DBGET integrated database retrieval system