KEGG   Desulfitobacterium dichloroeliminans: Desdi_2209Help
Entry
Desdi_2209        CDS       T02390                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desdi_2209
Enzymes [BR:ddl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desdi_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2255044..2258571)
Genome map
AA seq 1175 aa AA seqDB search
MEVQAYHHSHSEFFRNPFGAAPRGSRIQLRIHLKGTEWIEECLLRLWEGGKEVLLPMVPS
VETPSSFPEEGVTFQVDYRVPDEPGLVWYFFMFKVREEVYYYGNNENQLGGEGQIYDQEP
PGYQITVYNPMCMPDWYTRGIMYQIYVDRFFDGIEGGKLNNLPPKALLHGDWHDTPFYIK
NEKGEVLRWDFFGGNLLGVLKRLPYLKELGISIIYLNPIFAASSNHKYDTGDYLTIDPMY
GDISIFDSLVKEARRLGISILLDGVFSHTGDDSIYFNRYGNYPSLGAYQSPDSPYYSWYK
WQEEGVYSCWWGVKTLPEVNELDASYRNYIIHSPQGVLQTWMNRGIKGWRLDVADELPDE
FIKEFRQVMKALDPEAVLIGEVWEDPTNKSSYGKLRQYFWGSELDGTMNYPFREIFLQFL
LGDQNAYQLHQRIMNLYENYPRENFFGQMNLIGSHDRARILTLLGEAPAPEDLTVYEQED
YRLPPHHRWLATQRLKLFTLIQMSFPGVPCVYYGDEAGLEGYPDPYNRGTYPWGREDQEI
LHWVKRVLRYRQEYDVLQQGDFVSWPLEGDVYSFKRRGEKEEIITLVNRSSQWPRVIKIE
LEKDIQQVIDLFEGVVIYAKADLDIQTEERIEIEITLPPLTGKSLYCQKNFRDPFFKKEI
MTRSCGVLLSISSLPSAWGIGDFGNEAYDFVNFLAEGGQRIWQVLPLNPLDQGDSPYQSE
SAFAGNPLYISIDSLIQSELLKEEEARREYEDSVEQYLEADEGDGFTRVKAYKDNLLRLA
YRRFKHVMSQGESDDKEYLNPSNFEAFIQTNQVWLQDYAYFKCLKLKHQGLAWNKWEEKF
CLRDSEAIEVLTKEMAEEINVTYFIQYTFAYQWEKLKRYANTKGLTIMGDMPIFVGYDSS
DVWANQEFFNLDEENIPRGTAGVPPDYFSPTGQNWGNPLYDWDTLAKMDYVWWKERLRQG
LQRFDVLRLDHFRGFEAYWEIPRGANSAEQGRWLKGPGKRFFECLSREFGSLPLIAEDLG
TITSEVKVLKGIFGFPGMKVMQFSPMGEEVTVQKCSQGHNDHKCIYYSGTHDNDTLLGWF
LSQGYNTAQALKSVEVSIEELYKSQGTWVILPLQDILKLDSRARMNKPGTIAGNWNWRVE
KMSLTQDVSAKLRSLAIRYNRLAGEPITETGVGSY
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
gtggaagttcaagcttaccatcattcgcactctgaattttttcgcaacccctttggggcc
gctccacgtggaagcagaattcagctgagaattcatcttaaggggacagagtggattgaa
gaatgccttttgcgcctttgggagggaggcaaggaggttttgcttcctatggtcccttct
gtggaaaccccaagcagtttcccagaggaaggagtaactttccaagttgattatcgggta
ccggatgaacctgggcttgtctggtacttttttatgtttaaggtaagagaagaagtctat
tactacgggaacaacgagaaccaactgggtggtgagggtcaaatctatgatcaagagccc
ccaggatatcaaattaccgtctataaccctatgtgcatgcccgactggtatacccgtggc
atcatgtatcagatttatgtggatcgctttttcgatggaatcgaaggtggcaaacttaat
aatcttcccccgaaggctctgttgcatggggactggcacgatacccctttctatatcaaa
aatgaaaagggtgaggttctgcgctgggatttctttggtggaaacttgctaggagtccta
aaaagacttccctaccttaaggaactggggataagcatcatctacctgaatccgattttc
gctgcctcaagcaatcataagtatgataccggggattatctcaccatcgatcccatgtat
ggggatatatccatctttgactcattggtgaaagaggctcgtcgtttaggaatttcaatt
cttcttgatggagtctttagccataccggagatgatagcatttattttaatcgttatgga
aattatcccagcttgggagcctatcaatcccctgattcaccctattactcttggtataag
tggcaagaagagggggtatattcctgttggtggggagttaaaaccctaccggaagtgaat
gaactagacgcttcttaccgaaattatattatccattccccacaaggagtattgcaaacg
tggatgaaccgtggaattaagggctggcgcttggatgtggccgatgagcttccagatgaa
tttatcaaggaattccgtcaggtgatgaaagctttagaccccgaggcggttctgattggt
gaggtctgggaggaccccaccaataaatccagctacggaaaattacgccaatacttttgg
ggctcagaattagatggcaccatgaattatccgtttcgggagatttttctgcagtttttg
ctaggagatcagaatgcctaccagcttcaccagcgaatcatgaatttgtatgagaactac
ccccgggagaatttcttcggacaaatgaatttaatcggtagccatgaccgtgctcgcatt
ttaaccttgctgggagaagcgccggcgccggaagatcttacagtgtatgaacaggaagac
tatcgcttaccccctcaccaccgttggttggccactcaacgtttaaaactctttaccttg
attcaaatgagctttcctggtgtgccttgtgtgtattacggggacgaagcaggattggag
ggttatcctgatccctataaccgagggacctacccttgggggagagaagatcaggaaatt
ctgcactgggttaaacgagttctacgttatcggcaagagtatgatgtgctacaacagggt
gattttgtatcgtggcccttagagggggatgtttattccttcaaacggaggggagagaag
gaagaaattattacattggttaaccgtagttcacagtggccaagagtaataaagattgag
ctggagaaggatatacaacaggttattgatttgttcgagggagtagttatctatgcaaag
gctgatcttgatatacaaaccgaggaaagaatcgaaattgaaattaccctgcctcccttg
acgggcaagtctctatactgtcagaagaattttagagacccgtttttcaagaaggagata
atgactcgttcttgcggggttcttctgtccatttcctcccttccgtcagcttggggaatt
ggcgattttgggaatgaggcctatgattttgttaatttcttggctgaaggcggacaaaga
atatggcaggtccttcccttaaaccctctggatcagggagactcgccctatcagagtgaa
tcggcttttgccggtaatccactttatataagtattgattcactgattcaatcagagttg
ctgaaggaggaagaagcgcgaagagaatatgaagactctgttgaacagtatcttgaagct
gacgagggggacggctttactcgggttaaggcttataaagataacctattaaggttagct
taccggcgctttaagcatgtgatgtctcaaggggagtctgatgataaggaataccttaat
cctagtaactttgaagcgtttatccaaacgaaccaggtctggcttcaagattatgcctac
tttaaatgtttaaagctaaaacatcagggtttagcctggaataagtgggaagaaaagttt
tgtttaagagattcagaggctattgaagtcttaaccaaagaaatggctgaggaaataaac
gtcacttatttcattcaatacacctttgcttatcaatgggaaaagttaaagcgctatgcc
aacactaaagggctcacaattatgggggatatgccgatctttgtagggtatgacagtagc
gatgtttgggcgaatcaggagttctttaatcttgatgaagaaaacatccctagaggaacg
gctggagttcctccggattattttagtcctacggggcaaaattggggtaatcccttgtat
gattgggatactttggctaagatggattatgtatggtggaaggaacgtcttaggcaaggg
ttgcagcgctttgatgtattgcgcttggatcatttccgtggatttgaagcttactgggaa
atcccaaggggagcaaactctgcggaacaaggtcgttggctgaaaggaccggggaaacgg
ttttttgaatgcctgagtcgagaatttggctccttgccactgatagccgaagatttgggg
acgatcacatcggaagtgaaggtgctcaaaggcattttcggttttccggggatgaaggtc
atgcagttttcgccgatgggggaagaagttacagtacaaaagtgttcgcaaggccataat
gatcataaatgtatctattattccggaacccatgataatgacacccttttaggctggttt
ctatcccaagggtataatacggcacaggctctcaagagtgtcgaggtgagtattgaagag
ctgtataaaagccagggaacttgggttattcttcctctgcaagatattctaaaattggat
tctcgcgccagaatgaataaaccgggtacaattgcagggaattggaactggcgtgtggaa
aaaatgtctttaacccaagatgtcagtgcgaagttaaggagcttagctataagatataac
cgtttggccggagaaccaataacagagacaggagttggtagttattaa

DBGET integrated database retrieval system