KEGG   Desulfitobacterium dichloroeliminans: Desdi_2214Help
Entry
Desdi_2214        CDS       T02390                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desdi_2214
Enzymes [BR:ddl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desdi_2214
Exosome [BR:ddl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desdi_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2264849..2266747)
Genome map
AA seq 632 aa AA seqDB search
MTIELHKKDPLLTSKEMYLFNRGEFYHSFLKFGAHRIKNQERWGTFFALWAPYATKVSVV
GDFNGWCGVSHPMEKCGVHGIWTLFIPGLEEGEIYKYEILTDAEERVLKADPFAFFSEVR
PDTASVVYSLEGYPWHDQTWLNKRKTIDYKIMPLAIYEIHLGSWKSKEGGGFYSYREIAP
ELISYLKKMGYTHVEILPLQEHPYDGSWGYQGTGYYSSTSRYGTPHDLMALIDQCHQADI
GVIMDWVPGHFCKDAHGLGNFDGSALFEKEVHEHWGTYKFDYTRSEIWSFLISNAIFWLE
IYHVDGLRVDGVSSMLYLDYGKEDKTWEPNILGGREDLAAVQFIQRLNQAVDALFPDVLM
IAEEATDWQGVTRPLANQGLGFSFKWNMGWMNDTLRYIVLDFEQRKKYHQLLTFPMMYAY
SESYILPLSHDEVVHGKKSLLNKMPGNYEQKFAGLRSLMIYWICYPGKKLLFMGGELAQF
IEWREDRELDWFLLKFDIHRQYHLFVQQLNAIYREERALWENDLNWSGFEWIDVHNHEQG
ILVFCRKGEEHQDRLVVIINFQPHSYSGFRIGVEDAKGYREIISTDTADYGGAGVNNSGL
IMVESIPWHGREYSLELQIPSLGAILLKPVLA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgactatagaacttcataagaaagatcccctactcacctcaaaagagatgtatcttttt
aatcgcggtgagttttatcatagcttccttaaatttggagcacatcgtataaaaaatcag
gagcgatggggcacattcttcgccttatgggctccctatgcaactaaagtctcagtcgta
ggggattttaatggttggtgcggagtaagtcatcctatggaaaaatgtggggtccatggc
atatggactttatttatcccgggcttagaagaaggagagatttacaaatatgagattttg
actgacgctgaagaaagagtgctgaaagcggatccgtttgccttcttctccgaagtgagg
cccgatacagcttcagttgtatattccctagagggttatccttggcacgaccagacttgg
cttaacaaacgcaaaactattgactataaaatcatgcccttagccatttatgaaatacac
ctaggctcctggaaaagtaaggagggaggtggattttatagttaccgggaaattgcgcct
gagctcatcagttacttaaaaaaaatgggctatacccatgtggaaattttgcccttgcag
gagcatccctatgacgggtcatggggttaccagggaacaggatactattccagtaccagc
cgttatggtactccccatgatctgatggcgttgattgaccaatgtcatcaagcggatatc
ggggtgattatggattgggttccggggcatttttgcaaggatgcccatggcttggggaac
tttgatggaagtgctctctttgagaaagaagtccatgagcattggggtacctataaattt
gattatacccggtcggaaatatggagcttcttaatttctaatgcaatcttctggctggag
atttatcatgtggatggcctacgagtggatggggtaagtagtatgctctacttggattat
ggcaaagaggataaaacctgggagcctaacattttgggggggagagaagatttggcggcc
gtccaatttatacagcggcttaaccaagcggttgatgctctttttcctgatgttctgatg
attgccgaagaggcaacggattggcagggggtaactaggccactggcaaaccaagggtta
ggattctcatttaaatggaatatgggctggatgaatgatactctgcgctacattgtcttg
gattttgagcagagaaaaaagtatcatcagctcttaacctttcccatgatgtacgcctat
tctgaaagttatattctacccttatcccatgatgaggtagtccatggcaaaaagtcctta
ttaaataagatgcctggcaattacgagcaaaagtttgcaggattaagatccttaatgatc
tattggatctgttaccccgggaagaagctgctctttatggggggtgagcttgcgcagttt
atcgagtggcgtgaggatcgggagctggattggtttctccttaaatttgatattcatcgg
cagtatcacctatttgttcaacagcttaatgctatctatcgggaagaaagggctttatgg
gaaaacgacctgaactggtcaggatttgagtggatcgatgtccataaccatgagcaagga
atccttgtgttttgtcgtaaaggtgaagaacatcaggatcgtttagtggtgattatcaac
ttccagccccatagttactctggatttcggatcggagtggaggacgccaaagggtatagg
gaaatcattagtacggatacagcagactacggtggtgcgggtgtaaataattcaggactc
atcatggtggaaagcattccctggcatggacgagagtattcattggaacttcagattcct
tcgctgggagcaatcctcttaaaaccggtacttgcataa

DBGET integrated database retrieval system