KEGG   Desulfitobacterium dichloroeliminans: Desdi_2770Help
Entry
Desdi_2770        CDS       T02390                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ddl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ddl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819652..2820590)
Genome map
AA seq 312 aa AA seqDB search
MGWTRKDILHMEDLKPSEIQIIINTAKPMKEILSRAVKKLPTFRGRSVYNLFFESSTRTR
TSFETAAKILGADTTSLAVAQSSVNKGESLLDTVRTLQAMKPDLVVIRHSSSGAAHFLAK
ELKAGVINAGDGQHEHPTQALLDLYTMQEHLGSVEGKKILLVGDILHSRVARSNVWALKA
LGAEVVLVGPPTLLTPEIKSWGVKTTYHLDEELAGADVIMALRLQLERQKAGLLPSLREY
SQLYGITAERVQRTGKKTLIMHPGPVNRGVEIESSIVNSTQSVIEEQVTNGVAVRMAIMY
LLLGGGTNHVVD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggctggacacgcaaagatattctgcatatggaagatctgaaaccaagtgagatccaa
atcataatcaatacggcaaaacctatgaaggaaatcttgtcaagggccgtaaagaagctg
ccaacctttcgcgggagatcggtatataacttgttttttgaatcctctacccgcaccaga
acctcctttgagacagcggcgaagatacttggtgccgacaccaccagcttggcagtggct
cagagcagcgtcaataagggtgaaagtttgcttgataccgtaagaaccctgcaagccatg
aagccggatcttgtggtcattcgacactccagttcgggagcggcacattttcttgctaag
gaactgaaagcaggtgtgattaacgctggggatggacaacatgagcaccccacccaagcc
ttgcttgatttatataccatgcaggagcatctaggtagtgttgagggaaagaagattctc
ctcgtcggagatattctgcactcccgcgttgcccgtagcaatgtctgggcccttaaagcc
ttgggagcagaagtagtgctcgtcggccctccgaccttgctcactcctgaaattaaatcc
tggggtgtgaaaacaacctatcatctcgatgaagaactggctggagcggatgtcatcatg
gctttaaggctacagctcgagcggcaaaaggcagggctactgccgagtctgcgggaatac
tcgcaactctacgggattactgccgaaagagttcagaggaccggtaaaaagaccttgatt
atgcatcctggaccggtgaatcgaggggtagaaattgagagtagtatcgtcaattccacc
cagtcggttattgaggagcaagtaaccaacggcgtcgccgtccgcatggccattatgtat
ctattattgggagggggaacaaatcatgtggtggattaa

DBGET integrated database retrieval system