KEGG   Desulfitobacterium dichloroeliminans: Desdi_3354Help
Entry
Desdi_3354        CDS       T02390                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ddl  Desulfitobacterium dichloroeliminans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ddl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3439970..3441454)
Genome map
AA seq 494 aa AA seqDB search
MKKYILALDQGTTSCRAILFDRESHIVGVAQKEFTQIYPQPGWVEHDPEEIWSTQYGVIA
ELLARYHVKLEEISCIGITNQRETTVVWDKYTGKPIANAIVWQCRRTAPLCDELKEKGLE
PLFKEKTGLVLDAYFSGTKIRWILDHVPGAQEKAEKGDLLFGTMDTWLVWNLTKGQIHVT
DYSNASRTLLYNIKSLEWDEELLRLLRIPLAMLPEVKPSSYIYGKTAAEGFFGYELPLAG
IAGDQQAALFGQACFEPGMAKNTYGTGCFMLLNTGEEVCESRHGLVSTIAWGMDGKVVYA
LEGSVFIAGAVIQWLRDELKLIETAADSEYFAGKVSDNGGVYVVPAFTGLGAPYWDMDAR
GAIVGLTRGSNKNHIIRAALESMAYQTKDILKAMEADSGLLLQLLKVDGGAVSNNLLMQF
QADLLGVEVERPQCIETTALGAAYLAGLATGFWSDLEELKGKSRHDRSFEPRMSEELKEK
YYQGWKKAVRRVMD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacatattggctttagaccaaggaacaaccagttgccgagctattcttttc
gatagggaaagtcatattgtgggagtggcgcaaaaagaatttacccagatttacccccag
cccggttgggtggaacatgatccagaagagatttggagtacacagtatggtgtcatagca
gagctcttagctcgctaccacgtaaagcttgaagagatctcatgcattggaattaccaat
caacgggaaaccactgtagtttgggataagtacacgggaaagcctatcgccaacgctatt
gtttggcagtgtcgaagaacagcccccctctgtgatgaactaaaagaaaaagggctggaa
cccctgttcaaggaaaagacgggcttagttcttgatgcgtatttctcgggaacgaaaata
cgctggattcttgatcatgtacctggggctcaggaaaaggccgaaaagggtgacttgctc
tttggcactatggatacctggttggtgtggaatttaaccaagggtcagattcatgttact
gactattcgaatgcatctcgaactttactctataatataaagtctctagagtgggatgag
gagcttcttcgcttgttaaggattcccttagccatgcttccggaagtaaagccctccagt
tatatctatggcaaaacagcggccgaggggtttttcggttatgagcttcctctcgccgga
atcgccggggaccagcaagctgccttatttggccaagcctgttttgagccgggtatggcg
aaaaatacttatggtaccggctgctttatgcttctgaatacaggagaagaggtctgtgag
tctcggcatggtctcgtgagtaccattgcctgggggatggatggaaaagttgtttatgcc
ttggagggcagtgttttcatcgccggtgctgtgattcagtggctgcgggatgaattaaag
ctcatcgaaaccgctgcggattctgagtattttgcaggaaaagtttccgataacggggga
gtctatgtagtgcctgcttttactggactcggtgctccctactgggatatggatgctcgg
ggggcgattgttggccttacgcgtggtagtaataaaaaccatattatacgggcagccctt
gaatccatggcctaccagacgaaggatattttaaaagctatggaagctgactctgggtta
ctccttcaacttctaaaggtcgatgggggagcagtaagcaataatctcctcatgcagttt
caagcagacctattgggtgtagaagtagagcgtcctcagtgtattgaaactacagcatta
ggagccgcctatcttgctggtttggctacgggtttttggagtgatctagaggagttgaaa
ggaaagtcaagacatgaccgttcctttgaaccccgcatgagcgaagagcttaaagagaaa
tattatcaaggctggaaaaaggccgtcagacgggtcatggattga

DBGET integrated database retrieval system