KEGG   Desulfovibrio desulfuricans ND132: DND132_0006Help
Entry
DND132_0006       CDS       T01709                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DND132_0006
Enzymes [BR:ddn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DND132_0006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6133..7335)
Genome map
AA seq 400 aa AA seqDB search
MKTYISAWPATVPSPPFPRRLVILGATGSIGDSALKVVAGHPERFTVTALAGGRNGRKLA
ALCARFRPQYAAVLDDAARTEFLDNLPGDYAPELLVGPEAFDRLAALDEADLILSAIVGA
AGFAPTLAAARAGKMIGLANKESLVLGGHLIRAACRASGAVILPVDSEHNALFQGLAGHG
RDEEIARLILTASGGPFRGKDRAFLETVTREQALAHPNWSMGAKISVDSATLLNKGLELI
EACHLYGLPPDRVDVVVHPQSIVHSLVEYVDGSQLAHMGTPDMQVPIAHCLCFPERVTVD
VPRLRLAEVGRLTFEAPDLDAFPCLRLAREAFDAGPSHPIVLNAINEIAVDAFLHERIGF
TDIPAMIEAGLDRHAPVDVSTPEAVLALDREVRRETEARL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacatctccgcctggcccgccacggtgccgagcccgcccttcccgcgcaga
ctggtcatcctcggggccaccggctccatcggcgactcggccctcaaggtcgtcgccgga
cacccggagcggttcacggtcacggcccttgcgggcgggcgcaacggccgcaagctggcc
gccctgtgcgcccggttccggccgcaatacgccgccgtgctcgacgacgcggcgcgcacc
gaatttctcgacaacctgccgggcgactacgccccggaactcctggtcggccccgaggcc
tttgatcgcctggccgccctggacgaggcggacctgatcctgtccgccatcgtgggggcc
gccgggttcgcgcccaccctggccgccgcccgcgccggcaagatgatcggcctggccaac
aaggagtccctggtcctgggcggccacctcatccgcgccgcctgccgggcgtccggggcc
gtgatcctgcccgtggactccgagcacaacgccctgttccaggggctggccgggcacggc
cgggacgaggagatcgcgcgcctcatcctgaccgcttcgggcggcccgttccggggaaag
gaccgggcattccttgaaaccgtcacccgcgagcaggccctggcccatcccaactggagc
atgggcgccaagatttccgtggattcggccaccctgctgaacaaggggctggaactgatc
gaggcctgccatctctacggcctgcccccggaccgggtggacgtggtcgtccatccccag
tccatcgtccactccctggtggagtacgtggacggctcgcaactggcccacatgggcacc
ccggacatgcaggtgcccatcgcccactgcctgtgctttcccgagcgggtcaccgtggac
gtgccccggctccggctggccgaggtgggccgcctgaccttcgaggcgccggacctcgac
gccttcccctgcctgcggctggcccgcgaggccttcgacgccgggccgagccaccccatc
gtgctcaacgcgatcaacgaaatcgccgtggacgccttcctccacgagcgcatcggcttc
accgacatcccggccatgatcgaggccggacttgaccgccacgcccctgtggacgtatcc
acgcccgaggcggtcctggccctggaccgggaggtccggcgggaaaccgaggcccgcctc
tag

DBGET integrated database retrieval system