KEGG   Desulfovibrio desulfuricans ND132: DND132_0006Help
Entry
DND132_0006       CDS       T01709                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ddn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6133..7335)
Genome map
AA seq 400 aa AA seqDB search
MKTYISAWPATVPSPPFPRRLVILGATGSIGDSALKVVAGHPERFTVTALAGGRNGRKLA
ALCARFRPQYAAVLDDAARTEFLDNLPGDYAPELLVGPEAFDRLAALDEADLILSAIVGA
AGFAPTLAAARAGKMIGLANKESLVLGGHLIRAACRASGAVILPVDSEHNALFQGLAGHG
RDEEIARLILTASGGPFRGKDRAFLETVTREQALAHPNWSMGAKISVDSATLLNKGLELI
EACHLYGLPPDRVDVVVHPQSIVHSLVEYVDGSQLAHMGTPDMQVPIAHCLCFPERVTVD
VPRLRLAEVGRLTFEAPDLDAFPCLRLAREAFDAGPSHPIVLNAINEIAVDAFLHERIGF
TDIPAMIEAGLDRHAPVDVSTPEAVLALDREVRRETEARL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacatctccgcctggcccgccacggtgccgagcccgcccttcccgcgcaga
ctggtcatcctcggggccaccggctccatcggcgactcggccctcaaggtcgtcgccgga
cacccggagcggttcacggtcacggcccttgcgggcgggcgcaacggccgcaagctggcc
gccctgtgcgcccggttccggccgcaatacgccgccgtgctcgacgacgcggcgcgcacc
gaatttctcgacaacctgccgggcgactacgccccggaactcctggtcggccccgaggcc
tttgatcgcctggccgccctggacgaggcggacctgatcctgtccgccatcgtgggggcc
gccgggttcgcgcccaccctggccgccgcccgcgccggcaagatgatcggcctggccaac
aaggagtccctggtcctgggcggccacctcatccgcgccgcctgccgggcgtccggggcc
gtgatcctgcccgtggactccgagcacaacgccctgttccaggggctggccgggcacggc
cgggacgaggagatcgcgcgcctcatcctgaccgcttcgggcggcccgttccggggaaag
gaccgggcattccttgaaaccgtcacccgcgagcaggccctggcccatcccaactggagc
atgggcgccaagatttccgtggattcggccaccctgctgaacaaggggctggaactgatc
gaggcctgccatctctacggcctgcccccggaccgggtggacgtggtcgtccatccccag
tccatcgtccactccctggtggagtacgtggacggctcgcaactggcccacatgggcacc
ccggacatgcaggtgcccatcgcccactgcctgtgctttcccgagcgggtcaccgtggac
gtgccccggctccggctggccgaggtgggccgcctgaccttcgaggcgccggacctcgac
gccttcccctgcctgcggctggcccgcgaggccttcgacgccgggccgagccaccccatc
gtgctcaacgcgatcaacgaaatcgccgtggacgccttcctccacgagcgcatcggcttc
accgacatcccggccatgatcgaggccggacttgaccgccacgcccctgtggacgtatcc
acgcccgaggcggtcctggccctggaccgggaggtccggcgggaaaccgaggcccgcctc
tag

DBGET integrated database retrieval system