KEGG   Desulfovibrio desulfuricans ND132: DND132_0111Help
Entry
DND132_0111       CDS       T01709                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DND132_0111
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DND132_0111
Enzymes [BR:ddn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DND132_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120950..121519
Genome map
AA seq 189 aa AA seqDB search
MQVHETEFPGLLVLVPQVFQDERGFFLESYNANHFRELGITCTFIQDNHAYSRDVGVLRG
FHFQRPPQAQAKLVWVTRGAVLDVVVDLRIGSPTYGRWQHVILSAANFKRMFIPRGFGHA
YVTIMPDTEFQYKVDAPYAPALEGGLAWDDPDIGMDWDAALHGQEPILSEKDRRLSGLAG
FESPFTFEG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcacgagacggagtttcccgggctcctcgtcctggtcccccaggtcttccag
gacgagcggggcttttttctggaaagctacaatgccaatcatttccgggaactcggcata
acctgcacgttcatccaggacaatcacgcctattccagggacgtgggcgtgctgcgcggc
ttccacttccagaggccgccccaggcccaggccaagctcgtctgggtgacgcgcggcgcg
gtcctggacgtggtcgtggacctgcgcatcgggtcgcccacctacggccggtggcagcac
gtcatcctgagcgccgccaacttcaagcgcatgttcatccccaggggattcggccacgcc
tacgtgaccatcatgccggacaccgagttccagtacaaggtggacgcgccctatgcgccc
gccctggagggcggcctggcctgggacgacccggacatcggcatggactgggacgcggcc
ctgcatgggcaagagcccattctctccgaaaaggaccggcggctgtccggactggccggg
ttcgaatcacctttcaccttcgagggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system