KEGG   Desulfovibrio desulfuricans ND132: DND132_0161Help
Entry
DND132_0161       CDS       T01709                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00620  Pyruvate metabolism
ddn00630  Glyoxylate and dicarboxylate metabolism
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
ddn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DND132_0161
   00630 Glyoxylate and dicarboxylate metabolism
    DND132_0161
Enzymes [BR:ddn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DND132_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: EGB13379
UniProt: F0JDL0
Position
complement(176204..178387)
Genome map
AA seq 727 aa AA seqDB search
MTQRIEIGGLSIDGNLAEAVRTISAGTGLDETAFWTGAESVFRAFAPRNRELLAERDRIQ
AAMDEWHRAHPGQPGDKRTYHAFLREIGYLVPEGGDFTITTENVDPEIATIAGPQLVVPA
TNARFALNAANARWGSLYDALYGSDVIEKDAVPAKGYDPRRGQQVMAWAAAHLDTAVPLA
DGAHRDATAFAVTDGPAGRTVAVTLLDGRTTALRDPDQFAGYVEENGALKSLLFVKNGLH
IELRFDPEHRVGRDHPAGIKDVVLESAMSTILDCEDSVAVVDGEDKGLTYLNLFGLVMGD
LTASFDKGGRTVTRTLNDDRTYAAPGGGTVTLPGRSMLLVRTVGHLMTTDAVLMDGPDGY
EEVPEGILDTLATGLIFLHDLNGDGRWRNSRTGSVYIVKPKMHGPAEVAFTRDLFAAVEK
VLGLPALALKVGIMDEERRTTLNLKECIRQAAERVIFINTGFLDRTGDEIHTAMEAGPMV
RKEAIKAEPWIAAYEDWNVDIGLACGFSGRAQIGKGMWAKPDMMREMVETKGVHPRAGAN
CAWVPSPTAATLHALHYHQTDVFARQRELAGKMRASLDILTTLPLMRGERPSAEDVAHEL
ANNCQSILGYVVRWVDQGVGCSKVPDLSGTGLMEDRATLRISSQHLANWLRHGICTEEAV
LKTLKAMAEVVDRQNQGDPAYRPMAPDFDGSFAFQAARDLIFKGASQPNGYTEPILHARR
RQVKAAA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaagaatagagatcggcggcctgtccatagacgggaatctcgccgaagccgtc
aggaccatatcggcaggaaccggactggatgaaaccgccttctggaccggagccgaaagc
gtgttccgggcctttgccccgcgcaaccgcgaactgctggccgagcgcgaccgcatccag
gcggccatggacgaatggcaccgggcccatccgggccagcccggggacaagcggacctac
cacgccttcctgcgcgagatcggctatctcgtgcccgagggcggggacttcaccatcacc
accgaaaacgtggaccccgagatcgcgaccatcgccgggccgcagctggtcgtcccggcg
accaacgcccgctttgccctgaacgcggccaacgcccgctggggcagcctgtacgacgcc
ctgtacggctcggacgtcatcgagaaggacgcggtcccggccaaggggtacgacccccgg
cgcggccagcaggtcatggcctgggccgccgcccacctggacacggcggtgcccctggcc
gacggcgcccaccgcgacgccacggcctttgccgtgaccgacggcccggcgggaaggacc
gtggccgtgaccctgctcgacggccggaccaccgccctgcgcgacccggaccagttcgcg
gggtatgtggaggagaacggcgcgctcaagtccctgctcttcgtcaagaacggcctgcac
atcgaattgcggttcgaccccgagcaccgagttggccgcgaccacccggcgggcatcaag
gacgtggtcctggagtcggccatgtccaccatcctcgactgcgaggactccgtggccgtg
gtggacggcgaggacaagggactgacctacctgaatctcttcggcctggtcatgggcgac
cttacggccagcttcgacaagggcggccggaccgtgacccgcaccctgaacgacgaccgg
acctatgccgcgcccggcggcgggaccgtgaccctgccgggccggagcatgctcctggtc
cgcaccgtgggccacctgatgaccactgacgcggtgctcatggacgggcccgacggctac
gaggaggtgcccgagggcatcctcgacaccctggccaccggcctgatcttcctgcacgac
ctgaacggcgacggccgctggcgcaacagcaggaccggcagcgtgtacatcgtcaagccc
aagatgcacgggcccgccgaggtcgccttcacccgcgacctgttcgcggccgtggaaaag
gtcctgggactgcccgccctggccctcaaggtcggcatcatggacgaggagcggcggacc
accctgaatctcaaggagtgcatccggcaggcggccgaacgggtcatcttcatcaacacc
ggcttcctggaccgcaccggcgacgagatccacacggccatggaggccgggcccatggtc
cgcaaggaggccatcaaggccgaaccgtggatcgcggcctacgaggactggaacgtggac
atcggcctggcctgcggcttctcgggcagggcccagatcggcaagggcatgtgggcaaag
cccgacatgatgcgcgagatggtcgagaccaagggcgtccatcccagggccggggccaac
tgcgcctgggtgccttcgcccacggccgccaccctgcacgccctgcactaccaccagacc
gacgtgttcgcccgccagcgcgagctggccgggaagatgcgcgcctccctggacatcctg
accaccctgccgctcatgcgcggggagcgcccctcggccgaggacgtggcccatgaactg
gccaacaactgccagtccatcctcggctacgtggtccgctgggtggaccagggcgtgggc
tgctccaaggtcccggacctgagcggcacgggcctcatggaggaccgggccaccctgcgc
atctcgagccagcacctggccaactggctgcgccatgggatctgcaccgaagaggcggtt
ctgaagaccctcaaggccatggccgaggtggtggaccgccagaaccagggggacccggcc
taccggcccatggccccggacttcgacgggagcttcgccttccaggcggcccgcgacctg
atcttcaagggcgcgagccagcccaacggctacaccgaaccgatcctccacgcccggcgc
cgccaggtgaaggccgccgcgtaa

DBGET integrated database retrieval system