KEGG   Desulfovibrio desulfuricans ND132: DND132_0272Help
Entry
DND132_0272       CDS       T01709                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DND132_0272
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DND132_0272
Enzymes [BR:ddn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DND132_0272
Two-component system [BR:ddn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DND132_0272
Bacterial motility proteins [BR:ddn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DND132_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311905..312972
Genome map
AA seq 355 aa AA seqDB search
MRKIRVLIVDDSAVVRQTLEDILSSDPQIEIMGTAVDPYAAAERLKKEVPDVITLDIEMP
RMDGLTFLRKIMQQRPIPVVICSSVAGEGTSNAVKALEYGAVEIITKPKVGTKKFLEESK
IRLIDKVKAAALAGARPVRPAAPPVQVKPKLSADAVIAKGKPVAMSPTEKVCLVGASTGG
TEALRVFLEAQPENCPPIAIVQHMPEHFTAAFANRLNGICRITVKEAADGDAMMRGLALI
APGDKHLLLKRTGNKYYVEVKEGPLVSRHRPSVDVLFRSGARYGGANVVAAIMTGMGDDG
AKGMKELKDAGAYTIAQDEASCVVFGMPQEAIKEGGVDKVLSLEKIAPEIVRACG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagattcgagttctcattgtcgatgattccgcggtcgtccggcagacgctcgag
gacatcctgtcgtccgacccccagatcgagatcatgggcacggccgtggacccttacgcg
gccgccgagcggctcaagaaggaggtcccggacgtcatcaccctggacatcgagatgccg
cgcatggacgggctgacctttttgcgcaagatcatgcagcagcggcccattccggtggtc
atctgctcctccgtggccggggagggcacctccaacgcggtcaaggccctggaatacggg
gccgtggagatcatcaccaagcccaaggtggggaccaagaagtttctcgaggagtcgaag
atccggctcatcgacaaggtcaaggcggcggccctggccggggcccggcccgtgcgcccg
gcggccccgccggtccaggtcaagcccaagctcagcgcggacgcggtcatcgccaagggc
aagcccgtggccatgtccccaacggagaaggtctgcctggtgggcgcgtcaacgggcggc
accgaggcgctgcgcgtctttctcgaggcccagcccgagaactgcccgcccatcgccatc
gtccagcacatgcccgagcacttcacggcggcgttcgccaaccggctcaacggcatctgc
cggatcacggtcaaggaggcggcggacggcgacgccatgatgcgcggcctggccctgatc
gcgccgggcgacaagcacctgctcctcaagcgcacgggcaacaagtattacgtggaggtc
aaggagggtcccttggtctcgcggcaccggccctcggtggacgtgctcttccgctcgggg
gcgcggtacggcggggccaacgtggtggccgccatcatgaccggcatgggcgacgacggg
gccaagggcatgaaggagctcaaggacgccggggcgtacaccatcgcccaggacgaggcc
agctgcgtggtcttcggcatgccccaggaggccatcaaggaaggcggcgtggacaaggtc
ctgtccctggaaaagatcgcgccggagattgttcgagcctgcggctga

DBGET integrated database retrieval system