KEGG   Desulfovibrio desulfuricans ND132: DND132_0449Help
Entry
DND132_0449       CDS       T01709                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_0449
   01230 Biosynthesis of amino acids
    DND132_0449
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_0449
   00051 Fructose and mannose metabolism
    DND132_0449
   00562 Inositol phosphate metabolism
    DND132_0449
Enzymes [BR:ddn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DND132_0449
Exosome [BR:ddn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DND132_0449
  Exosomal proteins of bladder cancer cells
   DND132_0449
  Exosomal proteins of melanoma cells
   DND132_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495573..496328
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMYKTWGEAEATAGELVGLVADALPADREVLVFPPFTALKAVGDVFGPAAG
FSVGGQDFYTEEEGAFTGEISPNMLKDAGASFGLTGHSERRHVLGEDDALVGRKTAYGLS
QGLKVVLCIGELIEERRAGRVQEVLERQLRAGLADVPADMDPERLSVAYEPVWAIGTGEV
AGPAEIVEAHAFTRKILVSIFGEKANEMRILYGGSVKPGNCAEIIALDNVDGVLVGGASL
QGESFSRIVLA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctgatggcagccaactggaagatgtacaagacctggggcgaggccgaagcc
acggccggggaactggtcgggctggtcgcggacgcactcccggctgacagggaagtgctc
gtattcccgccatttaccgcactcaaggccgtgggcgacgtgttcggcccggcagccggt
ttttcggtcgggggccaggacttctatacagaggaggagggcgccttcaccggcgagatc
tccccgaacatgctcaaggacgcgggcgcttccttcggcctgaccggccactcggagcgc
aggcacgtgctcggcgaggacgacgcattggtgggtcgcaagaccgcctacgggctgtcc
cagggcctcaaggtcgtgctgtgcatcggcgagctcatcgaggagcgccgggcgggccgg
gtgcaggaggtgctcgagcgccagttgcgggccgggctcgcggacgtgcccgcggacatg
gaccccgagcgtctgtccgtggcctacgagccggtctgggccatcggcaccggagaggtg
gccggccctgcggaaatcgtcgaggcgcacgccttcacgcggaaaatcctcgtctccatc
tttggtgaaaaagccaatgaaatgaggatcttgtatggcggaagcgtcaagccgggcaac
tgcgctgaaattattgcgcttgacaacgtggatggagtattggtaggaggcgcgagcttg
cagggagaaagcttcagtcggatcgtactggcttga

DBGET integrated database retrieval system