KEGG   Desulfovibrio desulfuricans ND132: DND132_0459Help
Entry
DND132_0459       CDS       T01709                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506208..506711)
Genome map
AA seq 167 aa AA seqDB search
MICYVSLGSNVGDTEDNLHEALVLLEDYGDDIRLKKVSEYYETEPQGEIKDQPWFTNQVI
ELEIDAEIWSPPGFLSTCTAIEAKMGRTRAVPGGPRPLDMDIIAWGDTVMDMDFLTLPHP
RAKERAFVLVPLKEIAPDFVFPDGTTVDEALAAITYRQEGRKLWQDS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgatctgctacgtgagcctcggctccaacgtgggagacaccgaagacaacctccacgag
gccctggtcctgctcgaggactacggtgacgacatccgcctgaaaaaggtctcggaatac
tacgagaccgaaccccagggggagatcaaggatcagccgtggttcaccaaccaggtgatc
gagctcgagatcgacgccgagatctggtcgccgccgggcttcctgtccacctgcacggcc
atcgaggccaagatgggccgcaccagggccgtgcccggcggtcccaggccgctcgacatg
gacatcatcgcctggggcgacaccgtcatggacatggacttcctgaccctgccgcatccg
cgcgccaaggaaagggcgttcgtgctcgtgccgctcaaggagatcgccccggacttcgtc
tttcccgacgggaccaccgtggacgaggcgcttgccgccatcacgtaccggcaggaaggg
cgcaagctctggcaggactcctaa

DBGET integrated database retrieval system