KEGG   Desulfovibrio desulfuricans ND132: DND132_0518Help
Entry
DND132_0518       CDS       T01709                                 

Definition
(GenBank) peptidase dimerization domain protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00300  Lysine biosynthesis
ddn01100  Metabolic pathways
ddn01120  Microbial metabolism in diverse environments
ddn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    DND132_0518
Enzymes [BR:ddn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DND132_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DEDD_Tnp_IS110 DUF3197
Motif
Other DBs
NCBI-ProteinID: EGB13735
UniProt: F0JFQ7
Position
566842..568065
Genome map
AA seq 407 aa AA seqDB search
MDALFSELDRQTEAVVELQTRLTAIPALGPRNGGEGEKAKADFLLGHLQSMGIRDIREFN
APDPDVPCGYRPNIVAVVPGRNTEKTLWVISHIDVVPPGDLGLWNSDPYVVQRDGDTLVG
RGVEDNQQGMVSSLLTAKGLLDLKITPEMNYGLILVSDEETGSGFGLDYIVREHEDLFGK
DDLFLVPDSGEPSSEMVEVAEKSMFWVKITVIGKQCHASTPDQGVNSMFPSAEFILRIKE
LETLYPAEDALFSPPRSTFQPTMREANVANVNTMPGRDVFYVDCRVMPQYDLNDVLGTIR
AIGAEVAAKYGVTVECEPIMWEQAAPATPADSEIAVRTMASVRRIYHNNPHTVGVGGGTV
AAFLRRKGYDAVVWSTLNHNAHQPNEWSSIKSTIGDAKVIADMLLTR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgctcttttccgaactggaccgccagaccgaggcggtcgtcgaactgcagacc
agactgacggccattccggccctcggaccccgcaacgggggcgaaggcgaaaaggccaag
gccgacttcctgctcggccatctccaatccatgggtatccgggacatccgcgagttcaac
gccccggacccggacgtgccctgcggctaccgccccaacatcgtggcggtcgtccccggc
aggaacacggaaaagaccctgtgggtcatatcgcacatcgacgtggtccctccgggagac
ctcgggctgtggaattccgatccctacgtggttcagcgcgacggcgacaccctggtcggc
cggggcgtggaggacaaccagcagggcatggtctcctcgctgctgaccgccaaggggctg
ctcgacctgaagatcaccccggagatgaactacggcctgatcctcgtgtccgacgaggag
accggctcgggcttcggcctggactacatcgttcgcgagcacgaggacctcttcggcaag
gacgacctcttcctggtcccggattccggcgaaccctcctccgagatggtcgaggtggcc
gaaaagtccatgttttgggtcaagatcaccgtgatcggcaagcagtgccacgcctccacc
ccggaccagggcgtcaactccatgttccccagcgcggagttcatcctgcgcatcaaggag
ttggagaccctgtacccggccgaggacgccctgttcagcccgccccgctccaccttccaa
ccgaccatgcgcgaggccaacgtggccaacgtgaacaccatgcccggccgggacgtgttc
tacgtggactgccgggtcatgccccagtacgacctgaacgacgtactcggaaccatccgg
gccattggcgccgaggtggcggccaagtacggcgtgaccgtggagtgcgagccgatcatg
tgggagcaggccgcaccggccaccccggcggacagcgagatcgcggtccggaccatggcc
tcggtgcgcaggatctaccacaacaatccgcataccgtgggcgtgggcggcggcaccgtg
gccgcgttcctgcgtcgcaagggctacgacgccgtggtctggtccaccctgaaccacaac
gcgcaccagcccaatgaatggtcttccatcaagagcaccatcggcgacgccaaggtcatc
gccgacatgctcctgacccggtag

DBGET integrated database retrieval system