KEGG   Desulfovibrio desulfuricans ND132: DND132_0577Help
Entry
DND132_0577       CDS       T01709                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DND132_0577
DNA repair and recombination proteins [BR:ddn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DND132_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633136..633741)
Genome map
AA seq 201 aa AA seqDB search
MQNLPGPLKEVVDQLSSLPGIGPKSALRIALTLLKMPRERAAGVGQSILDLRERLCLCED
CACLAESSPCAICADATRDTGQLCLVPEWDALLALEEMGVYRGKYLVLGGLLSPLDGVDP
GQLEIERLRRRLASGDFSELILALGATLDAESTASYVKNLVESEFPGVSVTRLAQGIPMG
AEVKYMDKETLKQSLVHRQKM
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaccttcccggaccgctcaaggaagtggtcgatcaactgtcgagcctgcccggc
atcggccccaaatccgccctgcgcatcgccctgaccctgctcaagatgccccgcgagcgg
gccgccggggtggggcagtccatcttggatctgcgcgagcggctctgcctgtgcgaggac
tgcgcctgcctggccgagtccagcccctgcgccatctgcgccgacgcgacgcgcgacacc
ggccagctctgtctggtgcccgaatgggacgccctcctggccctggaggagatgggcgtc
taccggggaaaatatctggtgctcggcgggctgttgtcccccctggacggcgtggacccc
ggccagctcgagatcgagcggctgcggcgcaggctggcctcgggcgatttctccgagctg
atcctggccttgggcgccaccctggacgccgagtccacggcctcctacgtcaagaacctg
gtggagtccgagttccccggggtctccgtgacccgcctggcccagggcatccccatgggg
gccgaggtcaagtacatggacaaggagaccctcaagcagtcgctggtccaccgccagaag
atgtga

DBGET integrated database retrieval system