KEGG   Desulfovibrio desulfuricans ND132: DND132_0596Help
Entry
DND132_0596       CDS       T01709                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_0596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_0596
   00052 Galactose metabolism
    DND132_0596
   00500 Starch and sucrose metabolism
    DND132_0596
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_0596
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DND132_0596
   00524 Butirosin and neomycin biosynthesis
    DND132_0596
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DND132_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650835..651797)
Genome map
AA seq 320 aa AA seqDB search
MAKILAADIGGTHSRFALFEARGNDLEMLDSIWLDTHGARTFPELLEQLWDSEFPVRPGG
FEAAVLAPAGAVYHGLTCPDLPNAPWGIDLREVDFGTPAVRLINDFSAQAYACRTSAVAD
ALVIQAGEPVDGETIGIIGAGTGLGYSALLRTGDTWTALPSEGGHMAFPFIGRDEAEYAE
FNRIESGRNWPEGDSVVTGLGLQLVHRFLTGEDLTPKEISARITPQSETTRWYARFYARA
CRNWAIGLMTTGGMFIAGGVAAKNPMFVQVPDFLEEFHNSHVYQEFLGTIPVRLNANQAS
GLFGAAFFGAQMLAGRGGRG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattctggccgccgacatcggcggcacccacagtcgtttcgccttgttcgag
gcgcggggcaacgacctcgagatgctggattccatctggctcgacacccacggggcgcgg
acctttccggagctcctggaacagctctgggacagcgagttcccggtccggccgggcggc
ttcgaggcggcggtcctggccccggccggggccgtgtaccacggcctgacctgcccggac
ctgcccaacgcgccgtggggcatcgacctgcgcgaggtggacttcggcacgcccgcagtg
cgcctgatcaacgatttttcggcccaggcctatgcctgccgcacctcggccgtggccgac
gccctggtcatccaggccggggagcccgtggacggagagaccatcgggatcatcggggcc
gggaccgggctcggctattccgcgctgctcaggaccggcgacacctggacggccctgccg
tcagagggcggacacatggccttccccttcatcggccgggacgaggccgagtacgcggag
ttcaaccgcatcgaaagcgggcgcaactggcccgagggggactccgtggtcaccggcctg
gggcttcaactcgtgcaccgcttcctgaccggcgaggacctgacgcccaaggaaatctcg
gcccggatcaccccgcaaagcgagaccacccggtggtacgcccggttctacgccagggcg
tgccgcaactgggccatcgggctgatgaccaccggcggcatgttcatcgcgggcggggtg
gcggccaagaaccccatgttcgtgcaggttcccgattttctggaggaatttcacaattcc
cacgtgtaccaggagttcctgggcaccatcccggtccggctcaacgccaaccaggcgagc
ggcctgttcggcgcggccttcttcggcgcacagatgctggccgggcgcggcggaagaggg
tga

DBGET integrated database retrieval system