KEGG   Desulfovibrio desulfuricans ND132: DND132_0701Help
Entry
DND132_0701       CDS       T01709                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_0701
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DND132_0701
Enzymes [BR:ddn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DND132_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755445..757172
Genome map
AA seq 575 aa AA seqDB search
MSRILRINCRTKEYTFEDDGPYAGLGGRALTSRVINKEVPATCHPLSAENKLVFATGLMG
GSTAANSGRLSVGAKSPLTGGIKESNSGGLFAHKMPKMGLKAIILEDKPAEDAPFSTLFI
TEDKVEFRDATDIVGMDNYPAHDKLLAQYGDKLVAAMIGPAGETLRKAATIQFTDPYKRP
ARSAGRGGTGAVLGSKKIKAIVLDPEVNEKVSAADADAFKEARTTWVSILKGHPVTSQGL
PAYGTNVLVNIINEAGAMPTKNFRYGQCEHAAEISGEKIADLIKERGGKTTEGCHTGCII
QCSQQYNDANGNYVTSGFEYETVWALGANSLIKDIDDIALMDRICDEKGMDTIEIGNTVA
VAMDGGIIPWGDGKAAIELLKKVGTNDPLGMIIGNGVDFAGGAFGVERLPTVKGQSMPAY
DPRAVKGVGVTYATTPMGADHTAGYGVTANCLGVGGSIDGHKKEGNVELSKNLQVATAAI
DSMGFCLFVAFAVLDSDNGVQTMADLVQSWTGNSFSVDDLVALGAGALKDELDFNERAGF
SKIDDQLPRFFETDPLPPHNVIWDYTVEELQDAKV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaattctgagaatcaactgtcggacgaaggaatacacctttgaggatgacggc
ccctacgccgggctcggcggtcgcgccctgacttccagggtgatcaacaaagaggtcccg
gccacctgtcatcccctgtcggccgagaacaagctggtcttcgccaccggcctgatgggc
ggctccaccgcggccaactccggccgtctgtccgtgggcgccaagtcccccctgaccggc
ggcatcaaggagtccaactccggcggcctgttcgcccacaagatgcccaagatgggcctc
aaggccatcatcctcgaagacaagcccgccgaagacgcgcccttctccaccctgttcatc
accgaggacaaggttgaatttcgcgatgccaccgacatcgtcggcatggacaactatccc
gcccatgacaagctcctggcccagtacggcgacaagctcgtcgcggccatgatcggaccc
gccggcgagaccctgcgcaaggccgccaccatccagttcaccgatccgtacaagcggccc
gcccgctctgccggtcgcggcggcaccggcgccgttctcggctccaagaagatcaaggcc
atcgtcctcgaccccgaggtcaacgagaaggtctcggccgccgacgcggacgccttcaag
gaagcccggaccacctgggtctccatcctcaagggccatccggtcacctcccagggcctg
cccgcctacggcaccaacgtcctggtcaacatcatcaacgaggcgggcgccatgcccacc
aagaacttccgctacggccagtgcgagcacgccgccgagatctccggcgagaagatcgcc
gacctgatcaaggaacgcggcggcaagaccaccgaaggctgccataccggctgcatcatc
cagtgctcccagcagtacaacgacgccaacggcaactacgtgacctccggctttgagtac
gagaccgtctgggccctgggcgccaactccctgatcaaggacatcgacgacatcgccctc
atggaccgcatctgcgacgaaaagggcatggacaccatcgagatcggcaacaccgtggcc
gtggccatggacggcggcatcatcccctggggtgacggcaaggccgccatcgagctgctc
aagaaggtcggcaccaacgatcccctgggcatgatcatcggcaacggcgtggacttcgcc
ggcggcgccttcggcgtggagcgcctgcccaccgtcaagggccagtccatgcccgcctac
gacccgcgtgcggtcaagggcgtcggcgtgacctacgccaccacccccatgggcgctgac
cacaccgccggttacggcgtcaccgccaactgcctgggcgtgggcggctccatcgacggc
cacaagaaggaaggcaacgtcgagctgtccaagaacctccaggttgccaccgcggccatc
gactccatgggcttctgcctgttcgtggccttcgcggtcctggattccgacaacggcgtc
cagaccatggccgacctggtccagtcctggaccggcaacagcttctccgtggacgacctg
gtcgccctgggcgctggtgccctgaaggacgaactggacttcaacgagcgcgccggcttc
tccaagatcgacgaccagctgccccgcttcttcgagaccgatcccctgccgcctcacaac
gtcatctgggattacaccgtggaagaactccaggacgccaaggtctaa

DBGET integrated database retrieval system