KEGG   Desulfovibrio desulfuricans ND132: DND132_0735Help
Entry
DND132_0735       CDS       T01709                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_0735
   01230 Biosynthesis of amino acids
    DND132_0735
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_0735
  Energy metabolism
   00680 Methane metabolism
    DND132_0735
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_0735
Enzymes [BR:ddn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DND132_0735
Exosome [BR:ddn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DND132_0735
  Exosomal proteins of melanoma cells
   DND132_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790132..790878)
Genome map
AA seq 248 aa AA seqDB search
MHTLVLIRHGQSAWNLENRFTGWTDVDLTEQGVREAVDGAKLLKEAGLTFDVAHTSLLRR
AIRTLWLVQDEMDLMWLPVFKTWRLNERHYGALQGLNKAETARKYGDEQVFVWRRSFDTP
PPELDPSDPRFPGNDPRYASLAPEELPRCESLKLTIERTMPYWFETIAPEVRAGRRVLIV
AHGNSLRGLVKYLDTMSDEAITQLNIPTGLPLVYELNDDLTPLRHYYLGDPEAAARAAEA
VANQAKGE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcatacattggtattgatccggcacgggcagagcgcctggaacctggagaaccggttc
accggctggaccgacgttgacctgaccgagcagggcgtgcgcgaggccgtggacggcgcg
aagctcctcaaggaggccgggctgaccttcgacgtggcccacacctcgctgcttcggcgg
gccatccgcaccctctggctggtccaggacgaaatggacctcatgtggctgccggtcttc
aagacctggcggctcaacgagcgccactacggcgcgctccagggactgaacaaggccgag
accgcccggaagtacggcgacgagcaggttttcgtctggcggcgcagcttcgacaccccg
ccgccggagctggacccgtccgacccccggtttcccggcaacgacccgcgctacgcctcc
ctcgccccggaggaactgccgcgctgcgagagcctcaagctgaccatcgaacggaccatg
ccctactggttcgagaccatcgccccggaggtccgggcgggcaggcgggtcctcatcgtg
gcccacggcaactccctgcgcggcctggtaaagtacctggacaccatgtccgacgaggcc
atcacccagctgaacatccccacggggctgcccctggtctatgagctgaacgacgacctg
accccgctgcgccattactacctgggcgaccccgaggccgcggccagggccgccgaggcg
gttgccaaccaggccaagggggagtaa

DBGET integrated database retrieval system