KEGG   Desulfovibrio desulfuricans ND132: DND132_0750Help
Entry
DND132_0750       CDS       T01709                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DND132_0750
Enzymes [BR:ddn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DND132_0750
   3.1.2  Thioester hydrolases
    3.1.2.-  
     DND132_0750
Lipid biosynthesis proteins [BR:ddn01004]
 Fatty acid synthase
  Component type
   DND132_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803687..804253
Genome map
AA seq 188 aa AA seqDB search
MSGPLRIACFGDSLTEGYGLAPDEALPAVLERDLLDLGIEARCLNFGVSGDTAEDGLNRL
RMVLDADPDGVVLAFGANDCFLDEPVDEVAARLSSLIEAFRKRDLPVLLVGVNAGLNPDE
AYRARFEAVFPDLAERYDLPLFPDILAPYQGDPSMTLLDGLHPNETGVEAMARALLPQVE
ALARGIRP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggaccgctgcgcatcgcctgcttcggcgacagcctgaccgaggggtacggcctg
gccccggacgaggccctgcccgccgtcctggaacgcgacctgctcgacctggggatcgag
gcgcgctgcctcaatttcggagtgtccggcgacacggccgaggacggcctgaaccgcctg
cgcatggtcctcgacgccgacccggacggggtggtcctggccttcggggccaacgactgc
tttctggacgagccggtggatgaggtggcggcgcggctgtccagcctgatcgaggccttc
cgcaagcgggacctcccggtcctgctggtgggggtcaacgcggggctcaacccggacgag
gcctaccgggcgcggttcgaggccgtgttcccggacctggccgagcgctacgatttgccc
ctgttcccggacatcctcgccccgtaccagggcgacccgtccatgaccctgctggacggc
ctgcaccccaacgagaccggggtggaggcaatggcccgcgccctgctcccccaggtggag
gccctggcgcgcggcatcaggccgtag

DBGET integrated database retrieval system