KEGG   Desulfovibrio desulfuricans ND132: DND132_0750Help
Entry
DND132_0750       CDS       T01709                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ddn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803687..804253
Genome map
AA seq 188 aa AA seqDB search
MSGPLRIACFGDSLTEGYGLAPDEALPAVLERDLLDLGIEARCLNFGVSGDTAEDGLNRL
RMVLDADPDGVVLAFGANDCFLDEPVDEVAARLSSLIEAFRKRDLPVLLVGVNAGLNPDE
AYRARFEAVFPDLAERYDLPLFPDILAPYQGDPSMTLLDGLHPNETGVEAMARALLPQVE
ALARGIRP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggaccgctgcgcatcgcctgcttcggcgacagcctgaccgaggggtacggcctg
gccccggacgaggccctgcccgccgtcctggaacgcgacctgctcgacctggggatcgag
gcgcgctgcctcaatttcggagtgtccggcgacacggccgaggacggcctgaaccgcctg
cgcatggtcctcgacgccgacccggacggggtggtcctggccttcggggccaacgactgc
tttctggacgagccggtggatgaggtggcggcgcggctgtccagcctgatcgaggccttc
cgcaagcgggacctcccggtcctgctggtgggggtcaacgcggggctcaacccggacgag
gcctaccgggcgcggttcgaggccgtgttcccggacctggccgagcgctacgatttgccc
ctgttcccggacatcctcgccccgtaccagggcgacccgtccatgaccctgctggacggc
ctgcaccccaacgagaccggggtggaggcaatggcccgcgccctgctcccccaggtggag
gccctggcgcgcggcatcaggccgtag

DBGET integrated database retrieval system