KEGG   Desulfovibrio desulfuricans ND132: DND132_0874Help
Entry
DND132_0874       CDS       T01709                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DND132_0874
   00052 Galactose metabolism
    DND132_0874
   00500 Starch and sucrose metabolism
    DND132_0874
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_0874
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DND132_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935462..936337)
Genome map
AA seq 291 aa AA seqDB search
MDITKAVIPVAGWGTRSLPATKNVPKEMLPIFRKPIVQYIVEEGISAGLKDVVFITNQNK
TIIEDHFDRNFLLEQLLERAGKTAMLEEVRRVASLVNVIGVRQKQQLGLGHAVLTAREVC
QDQPFAVMLGDDLMFGVQTGIGELIKTAKETGKAVIGVIEVPKAKVSRYGVIQGEAIDSH
TYRVTSLVEKPAPEKAPSNLAIIGRYVLLPEIFDILEGQRAGVGGEIQLTDALQGLADRD
KLLAVRLGGQRFDAGDWVEYLTANIYFALQDEELRDDLVKRLRELLSCSST
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaccaaagccgtcatcccggtcgctggctggggcacccgttcactcccggcc
actaagaacgtccccaaggagatgctgccgatcttccgcaagcccatcgtgcagtacata
gtggaggagggcatcagcgcgggcctgaaggacgtggtcttcatcaccaaccagaacaag
accatcatcgaggaccacttcgaccgcaacttcctcctggagcagctcctggagcgcgcg
ggcaagaccgccatgctcgaggaggtccgccgcgtggccagcctggtcaacgtcatcggc
gtgcgccagaaacagcagctcggcctgggacacgcggtgctgaccgcccgcgaggtctgt
caggaccagcccttcgcggtcatgctcggcgatgacctcatgttcggcgtgcagaccggc
atcggcgagctgatcaagaccgccaaggagaccggcaaggccgtcatcggcgtcatcgag
gtgcccaaggccaaggtcagccgctacggcgtgatccagggcgaggccatcgactcgcac
acctaccgcgtgaccagcctggtggaaaaacccgcgcccgagaaggccccgtccaacctg
gccatcatcggccgctacgtcctgctgcccgagatattcgacatcctcgagggccagcgc
gcgggcgtgggcggcgagattcagctgaccgacgcccttcaggggctggccgaccgggac
aagctcctggcggtccggctgggtggccagcggtttgacgcgggcgactgggtggaatat
ctcacggccaacatctacttcgccctgcaggacgaggaactgcgcgacgatctcgtcaag
cggctgcgggaactgttgtcctgctcctcgacctaa

DBGET integrated database retrieval system