KEGG   Desulfovibrio desulfuricans ND132: DND132_0903Help
Entry
DND132_0903       CDS       T01709                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ddn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967535..968839
Genome map
AA seq 434 aa AA seqDB search
MDCRDLTYANPDDWPGIARWLEKRKDPDTKVDTIVRGILADVRERGDEALAEYTRKFDCA
SFDAADLRVPEEAIAAALAEIPDDDAAILREAIERVRTFHLNQKEKSWWTTAEDGTILGQ
MVRPVDRVGLYVPGGQGGETPLISSLIMNAVPAQVAGVGSIAVTSPPRKDGTLNPYILAT
AALLGLSEIYLAGSAWAVAALAFGTKTIAPCDVLAGPGNIFVATAKSQLIGRVGIDMVAG
PSEIVILADGSANPAWLAADMLSQAEHDPLAASILVTPDADLAARVRAELDTQCAALPRC
EIASKSLANWGAIITVPDIPTGAEMVNLLAPEHLELAVADPWSLLGSIRHAGAIFMGHNS
PEPVGDYFAGPNHVLPTLRTVRFSSALSVQNFCKKSSVIAASPSYVSEHGAKIARLARLE
GLEAHARSVEQRNK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggattgcagagatttgacttacgcgaacccggacgactggcccggcatcgcccgctgg
ctggaaaagcgcaaggacccggacaccaaggtggacaccatcgtgcggggcatcctcgcc
gatgtccgcgagcggggcgacgaggccctggccgaatacacccgcaaattcgactgcgcg
tcctttgacgcggccgacctccgcgtgcccgaagaagccatcgcggccgccctggccgag
atcccggacgacgacgcggccatcctccgcgaggccatcgagcgagtacgcaccttccac
ctgaaccagaaggaaaagtcctggtggaccaccgccgaggacggcaccatcctcggccag
atggtccggcccgtggaccgcgtggggctgtacgtgcccggcggccagggcggcgagacc
ccgctcatctccagtctgataatgaacgcggtcccggcccaggtggccggggtcggctcc
atcgccgtgacctcgcccccgcgcaaggacggcaccctcaacccgtacatcctggccacc
gccgccctgctcgggctgagcgaaatatacctggccgggtccgcctgggccgttgcggcc
ctggccttcggcaccaagaccatcgcgccgtgcgacgtcctggccggtccgggcaacatc
ttcgtggccacggccaagtcccagctcatcggccgggtgggcatcgacatggtcgcgggc
ccgtccgagatcgtcatcctggccgacggctcggccaacccggcctggctggccgcggac
atgctctcccaggccgaacacgaccccctggccgcgtccatcctggtcaccccggacgcg
gaccttgccgcccgggtgcgcgcggagctggacacccagtgcgcggccctgccccgctgc
gaaatcgcctcgaaatccctggccaactggggcgcgatcatcaccgtgcccgacatcccc
accggggcggagatggtcaacctgctcgcccccgagcacctggaactggccgtggccgac
ccgtggtccctgctcggctccatccgccacgccggtgccatcttcatgggccacaattcg
cccgaacctgtgggcgactacttcgccgggcccaaccatgtgctgcccaccctgcgtacg
gtccgtttttcctccgccctgtcggtgcagaacttctgcaagaaatccagcgtgatcgcc
gcgagcccgagctacgtgtccgagcacggcgccaagatcgcccggctggcccggctggaa
ggcctcgaagcccacgcccgcagcgtggaacaacgcaacaaatag

DBGET integrated database retrieval system