KEGG   Desulfovibrio desulfuricans ND132: DND132_0913Help
Entry
DND132_0913       CDS       T01709                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DND132_0913
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_0913
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DND132_0913
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DND132_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975909..977357
Genome map
AA seq 482 aa AA seqDB search
MTADLFPSYRGHMEYFCLGCGKRFPTDELYYTCPDCGGVFLLDNLKFDELKKTSGKEWRA
IFDARAASKKTALRGIFRFYELMAPVLEEEDIVYLGEGNTPLVASSPALNAATGLTTAYK
NDGQNPSASFKDRGMACGFSYLRSLIRRHGWDQILTVCASTGDTSAAAALYASYAGGAIK
SVVILPYGKVTPAQLAQPLGSGAVVLEVPGVFDDCMKVVEHLADNYRVALLNSKNAWRIL
GQESYAFECAQWFDWDMKGKCIFVPIGNAGNITAIMAGFLKLYDLGIIEELPRIFGVQSH
HADPVYRYYAVDDPKEREYHPMKVSASVAQAAMIGNPVSFPRVKYFAEKFEAVGGKRAFQ
VLQVTEQQIMDSMIQANRNGHIACTQGGESFAGAKRALELGLVTKDELCILDSTAHQLKF
VDFQNMYFDNAFPPEFGVKPDMALANKPQLIISPEEKDSLSEAEYTRRTADNVVARLGLE
KK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgacctttttccctcctatcgcggacacatggaatacttctgcctgggctgc
ggcaagcgattccccacggatgagctgtactacacctgcccggactgcggtggcgtgttc
ctgctcgacaacctgaagttcgacgagttgaagaagacctccggcaaggaatggcgggcc
atcttcgacgcccgcgcggcctccaagaagaccgccctgcgcggcatcttccgcttctac
gagctgatggccccggtgctggaggaggaggacatcgtctacctcggcgagggcaacacc
ccgctggtggcctcgagcccggccctcaacgcggccacgggcctgaccacggcctacaag
aacgacggccagaacccgtcggcctcgttcaaggaccggggcatggcctgcggcttctcc
tatctgcgctcgctcatccgccgccatggctgggaccagattttgacggtctgcgcctcc
accggcgacacctcggccgcggcggcgctctatgcctcctacgcgggcggggcgatcaag
tccgtggtcatcctgccctacggcaaggtcactccggcccagctggcccagccgctcggc
tccggggccgtggtcctggaagtgcccggcgtgttcgacgactgcatgaaggtggtcgag
cacctggccgacaactaccgcgtggccctgctcaactccaagaacgcctggcgcatcctg
ggccaggagtcctacgccttcgagtgcgcccagtggttcgactgggacatgaagggcaag
tgcatcttcgtgcccatcggcaacgcgggcaacatcaccgccatcatggccggtttcctc
aagctctacgacctcggcatcatcgaggagctgccgcgcatctttggcgtgcagtcccac
cacgcggacccggtctaccgctactacgcggtggacgaccccaaggaacgcgagtaccac
cccatgaaggtcagcgcctccgtggcccaggcggccatgatcggcaacccggtgtccttc
ccgcgcgtcaagtatttcgccgagaagttcgaggccgtgggcggtaaacgcgccttccag
gtcctccaggtgaccgaacagcagatcatggactccatgatccaggccaaccgcaacggg
cacatcgcctgcacccagggcggcgagtcctttgccggggccaagcgggccctggagctc
ggcctggtcaccaaggacgagctgtgcatcctcgactccacggcccatcagctcaagttt
gtggatttccagaacatgtatttcgacaacgccttcccgcccgagttcggggtcaagccg
gacatggcgctcgccaacaagccgcagctgatcatctcgcccgaggagaaggacagcctg
tccgaggcggaatacacccgccggaccgcggacaacgtggtcgcccgtctcgggctggaa
aaaaagtag

DBGET integrated database retrieval system