KEGG   Desulfovibrio desulfuricans ND132: DND132_1350Help
Entry
DND132_1350       CDS       T01709                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DND132_1350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_1350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DND132_1350
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DND132_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1499116..1500399
Genome map
AA seq 427 aa AA seqDB search
MNKTPRPDHVTGMRCTICGKTYLPGEVDYVCPDHGNEGILDIQYDYDAIGRQISPQTLAR
DKTCSQWRYRPLLPVLPETPAPAAAVGWTPLYESPRLASALRLDTLFVKDDSRQPTGSLK
DRASALAVMKAREAGADMITTASTGNAAAALAGMCAASDMPCTIFVPRSAPRAKVAQLLA
YGARVFLVDGSYDDAFELCLKAAAEYGWYNRNTGFNPYMAEGKKTAAFEICEQLDWRCPD
AVFVGVGDGCIISGLHKGFLDMYRLGWIDRLPRLMGVQAEGSDFLYRCWKAGADPVTFPA
IRAHTVADSISAGLPRDRKKAMESVTDTGGAFLRVSDEAILQAIPELARATGVFAEPAGA
SPLAGLHAAVDQGLVRSDAVCVLLVTGSGLKDVDATIRACAAEPRVIAPTLDALDKAMNT
ATRNQES
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacaccccgacccgatcacgtcacagggatgcgctgcaccatctgcggcaag
acctacctccccggcgaggtggactacgtctgccccgaccacggcaacgaaggcatcctg
gacatccaatacgactacgacgccatcgggcgacagatttccccccagaccctggcccgg
gacaagacgtgcagccagtggcgctaccgcccgctcctgccggtcctgccggagaccccg
gcgcccgccgccgccgtgggctggaccccgctctacgagagcccccgcctggcgagcgcc
ctgcgcctcgacaccctgttcgtcaaggacgactcgcgccagcccaccggctccctcaag
gaccgggccagcgccctggccgtgatgaaggcgcgcgaggccggcgcggacatgatcacc
accgcctccacgggcaacgcggccgccgccctggcgggcatgtgcgcggccagcgacatg
ccgtgcaccatcttcgtgccccgctcggcccccagggccaaggtggcccagctcctggcc
tacggggcgcgggtcttcctggtggacggcagctacgacgacgccttcgagctgtgcctc
aaggccgccgccgagtacggctggtacaaccgcaacaccggcttcaacccgtacatggcc
gagggcaagaagaccgccgccttcgagatctgcgagcagctggactggcgctgcccggac
gcggtcttcgtgggcgtgggcgacggctgcatcatctccggcctgcacaaggggttcctg
gacatgtaccgcctgggctggatcgaccggttgccccggctcatgggcgtccaggccgag
ggcagcgacttcctgtaccgctgctggaaggctggggccgacccggtgaccttcccggcc
atccgggcccacaccgtggccgacagtatttccgcggggctgccccgcgaccgcaagaag
gccatggagagcgtgaccgacacgggcggcgcgttcctgcgcgtgtccgacgaggccatc
ctccaggccatccccgaactggccagggccaccggcgtgttcgccgagcccgccggggcc
tcgcccctggcagggctgcacgcggccgtggaccagggactggtccgcagcgacgccgtc
tgcgtgctcctggtgaccggctcggggctgaaggacgtggacgcgaccatccgcgcctgc
gccgccgagcccagggtcatcgccccgaccctcgacgccctggacaaggccatgaacacc
gccacgcgaaaccaagaatcataa

DBGET integrated database retrieval system